PDB entry 1k3l

View 1k3l on RCSB PDB site
Description: Crystal Structure Analysis of S-hexyl-glutathione Complex of Glutathione Transferase at 1.5 Angstroms Resolution
Class: transferase
Keywords: glutathione S-transferase, X-ray structure, S-hexyl glutathione, water structure
Deposited on 2001-10-03, released 2002-10-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.165
AEROSPACI score: 0.63 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glutathione s-transferase a1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1k3la1, d1k3la2
  • Chain 'B':
    Compound: glutathione s-transferase a1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1k3lb1, d1k3lb2
  • Heterogens: GTX, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1k3lA (A:)
    aekpklhyfnargrmestrwllaaagvefeekfiksaedldklrndgylmfqqvpmveid
    gmklvqtrailnyiaskynlygkdikeralidmyiegiadlgemilllpvcppeekdakl
    alikekiknryfpafekvlkshgqdylvgnklsradihlvellyyveeldsslissfpll
    kalktrisnlptvkkflqpgsprkppmdeksleearkifrf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1k3lB (B:)
    aekpklhyfnargrmestrwllaaagvefeekfiksaedldklrndgylmfqqvpmveid
    gmklvqtrailnyiaskynlygkdikeralidmyiegiadlgemilllpvcppeekdakl
    alikekiknryfpafekvlkshgqdylvgnklsradihlvellyyveeldsslissfpll
    kalktrisnlptvkkflqpgsprkppmdeksleearkifrf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1k3lB (B:)
    kpklhyfnargrmestrwllaaagvefeekfiksaedldklrndgylmfqqvpmveidgm
    klvqtrailnyiaskynlygkdikeralidmyiegiadlgemilllpvcppeekdaklal
    ikekiknryfpafekvlkshgqdylvgnklsradihlvellyyveeldsslissfpllka
    lktrisnlptvkkflqpgsprkppmdeksleearkifrf