PDB entry 1k3i

View 1k3i on RCSB PDB site
Description: Crystal Structure of the Precursor of Galactose Oxidase
Class: Oxidoreductase
Keywords: 7 Blade Beta Propeller, Prosequence Form, Precursor of Copper Enzyme.
Deposited on 2001-10-03, released 2001-11-07
The last revision prior to the SCOP 1.73 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.176
AEROSPACI score: 0.67 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Galactose Oxidase Precursor
    Species: Fusarium spp
    Database cross-references and differences (RAF-indexed):
    • GB AAA16228 (Start-654)
      • modified residue (244)
    Domains in SCOP 1.73: d1k3ia1, d1k3ia2, d1k3ia3
  • Heterogens: GLC, CA, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1k3iA (A:)
    avgtgipegslqflslrasapigsaisrnnwavtcdsaqsgnecnkaidgnkdtfwhtfy
    gangdpkpphtytidmkttqnvnglsmlprqdgnqngwigrhevylssdgtnwgspvasg
    swfadsttkysnfetrparyvrlvaiteangqpwtsiaeinvfqassytapqpglgrwgp
    tidlpivpaaaaieptsgrvlmwssyrndafggspggitltsswdpstgivsdrtvtvtk
    hdmfcpgismdgngqivvtggndakktslydsssdswipgpdmqvargyqssatmsdgrv
    ftiggswsggvfekngevyspssktwtslpnakvnpmltadkqglyrsdnhawlfgwkkg
    svfqagpstamnwyytsgsgdvksagkrqsnrgvapdamcgnavmydavkgkiltfggsp
    dyqdsdattnahiitlgepgtspntvfasnglyfartfhtsvvlpdgstfitggqrrgip
    fedstpvftpeiyvpeqdtfykqnpnsivrvyhsislllpdgrvfngggglcgdcttnhf
    daqiftpnylynsngnlatrpkitrtstqsvkvggritistdssiskaslirygtathtv
    ntdqrripltltnnggnsysfqvpsdsgvalpgywmlfvmnsagvpsvastirvtq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1k3iA (A:)
    ipegslqflslrasapigsaisrnnwavtcdsaqsgnecnkaidgnkdtfwhtfygangd
    pkpphtytidmkttqnvnglsmlprqdgnqngwigrhevylssdgtnwgspvasgswfad
    sttkysnfetrparyvrlvaiteangqpwtsiaeinvfqassytapqpglgrwgptidlp
    ivpaaaaieptsgrvlmwssyrndafggspggitltsswdpstgivsdrtvtvtkhdmfc
    pgismdgngqivvtggndakktslydsssdswipgpdmqvargyqssatmsdgrvftigg
    swsggvfekngevyspssktwtslpnakvnpmltadkqglyrsdnhawlfgwkkgsvfqa
    gpstamnwyytsgsgdvksagkrqsnrgvapdamcgnavmydavkgkiltfggspdyqds
    dattnahiitlgepgtspntvfasnglyfartfhtsvvlpdgstfitggqrrgipfedst
    pvftpeiyvpeqdtfykqnpnsivrvyhsislllpdgrvfngggglcgdcttnhfdaqif
    tpnylynsngnlatrpkitrtstqsvkvggritistdssiskaslirygtathtvntdqr
    ripltltnnggnsysfqvpsdsgvalpgywmlfvmnsagvpsvastirvtq