PDB entry 1k3i

View 1k3i on RCSB PDB site
Description: crystal structure of the precursor of galactose oxidase
Deposited on 2001-10-03, released 2001-11-07
The last revision prior to the SCOP 1.71 freeze date was dated 2001-11-07, with a file datestamp of 2001-11-07.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.176
AEROSPACI score: 0.67 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1k3iA (A:)
    avgtgipegslqflslrasapigsaisrnnwavtcdsaqsgnecnkaidgnkdtfwhtfy
    gangdpkpphtytidmkttqnvnglsmlprqdgnqngwigrhevylssdgtnwgspvasg
    swfadsttkysnfetrparyvrlvaiteangqpwtsiaeinvfqassytapqpglgrwgp
    tidlpivpaaaaieptsgrvlmwssyrndafggspggitltsswdpstgivsdrtvtvtk
    hdmfcpgismdgngqivvtggndakktslydsssdswipgpdmqvargyqssatmsdgrv
    ftiggswsggvfekngevyspssktwtslpnakvnpmltadkqglyrsdnhawlfgwkkg
    svfqagpstamnwyytsgsgdvksagkrqsnrgvapdamcgnavmydavkgkiltfggsp
    dyqdsdattnahiitlgepgtspntvfasnglyfartfhtsvvlpdgstfitggqrrgip
    fedstpvftpeiyvpeqdtfykqnpnsivrvyhsislllpdgrvfngggglcgdcttnhf
    daqiftpnylynsngnlatrpkitrtstqsvkvggritistdssiskaslirygtathtv
    ntdqrripltltnnggnsysfqvpsdsgvalpgywmlfvmnsagvpsvastirvtq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1k3iA (A:)
    ipegslqflslrasapigsaisrnnwavtcdsaqsgnecnkaidgnkdtfwhtfygangd
    pkpphtytidmkttqnvnglsmlprqdgnqngwigrhevylssdgtnwgspvasgswfad
    sttkysnfetrparyvrlvaiteangqpwtsiaeinvfqassytapqpglgrwgptidlp
    ivpaaaaieptsgrvlmwssyrndafggspggitltsswdpstgivsdrtvtvtkhdmfc
    pgismdgngqivvtggndakktslydsssdswipgpdmqvargyqssatmsdgrvftigg
    swsggvfekngevyspssktwtslpnakvnpmltadkqglyrsdnhawlfgwkkgsvfqa
    gpstamnwyytsgsgdvksagkrqsnrgvapdamcgnavmydavkgkiltfggspdyqds
    dattnahiitlgepgtspntvfasnglyfartfhtsvvlpdgstfitggqrrgipfedst
    pvftpeiyvpeqdtfykqnpnsivrvyhsislllpdgrvfngggglcgdcttnhfdaqif
    tpnylynsngnlatrpkitrtstqsvkvggritistdssiskaslirygtathtvntdqr
    ripltltnnggnsysfqvpsdsgvalpgywmlfvmnsagvpsvastirvtq