PDB entry 1k3d

View 1k3d on RCSB PDB site
Description: Phosphoenolpyruvate carboxykinase in complex with ADP and AlF3
Deposited on 2001-10-02, released 2001-12-19
The last revision prior to the SCOP 1.59 freeze date was dated 2001-12-19, with a file datestamp of 2001-12-19.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.196
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1k3dA (A:)
    gltpqeleaygisdvhdivynpsydllyqeeldpsltgyergvltnlgavavdtgiftgr
    spkdkyivrddttrdtfwwadkgkgkndnkplspetwqhlkglvtrqlsgkrlfvvdafc
    ganpdtrlsvrfitevawqahfvknmfirpsdeelagfkpdfivmngakctnpqwkeqgl
    nsenfvafnltermqliggtwyggemkkgmfsmmnyllplkgiasmhcsanvgekgdvav
    ffglsgtgkttlstdpkrrligddehgwdddgvfnfeggcyaktiklskeaepeiynair
    rdallenvtvredgtidfddgsktentrvsypiyhidnivkpvskaghatkvifltadaf
    gvlppvsrltadqtqyhflsgftaklagtergiteptptfsacfgaaflslhptqyaevl
    vkrmqaagaqaylvntgwngtgkrisikdtraiidailngsldnaetftlpmfnlaipte
    lpgvdtkildprntyaspeqwqekaetlaklfidnfdkytdtpagaalvaagpkl