PDB entry 1k3a

View 1k3a on RCSB PDB site
Description: Structure of the Insulin-like Growth Factor 1 Receptor Kinase
Class: Transferase
Keywords: protein kinase, tyrosine kinase, tyrosine phosphorylation, protein-substrate complex
Deposited on 2001-10-02, released 2001-11-28
The last revision prior to the SCOP 1.73 freeze date was dated 2001-12-05, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.212
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: insulin-like growth factor 1 receptor
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08069 (0-298)
      • modified residue (173)
      • modified residue (177-178)
      • variant (254)
    Domains in SCOP 1.73: d1k3aa_
  • Chain 'B':
    Compound: insulin receptor substrate 1
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ACP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1k3aA (A:)
    vpdewevarekitmsrelgqgsfgmvyegvakgvvkdepetrvaiktvneaasmrerief
    lneasvmkefnchhvvrllgvvsqgqptlvimelmtrgdlksylrslrpemennpvlapp
    slskmiqmageiadgmaylnankfvhrdlaarncmvaedftvkigdfgmtrdiyetdyyr
    kggkgllpvrwmspeslkdgvfttysdvwsfgvvlweiatlaeqpyqglsneqvlrfvme
    gglldkpdncpdmllelmrmcwqynpkmrpsfleiissikeemepgfrevsfyyseenk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1k3aA (A:)
    vpdewevarekitmsrelgqgsfgmvyegvakgvvkdepetrvaiktvneaasmrerief
    lneasvmkefnchhvvrllgvvsqgqptlvimelmtrgdlksylrslrpempslskmiqm
    ageiadgmaylnankfvhrdlaarncmvaedftvkigdfgmtrdiyetdyyrkggkgllp
    vrwmspeslkdgvfttysdvwsfgvvlweiatlaeqpyqglsneqvlrfvmegglldkpd
    ncpdmllelmrmcwqynpkmrpsfleiissikeemepgfrevsfyyseenk
    

  • Chain 'B':
    No sequence available.