PDB entry 1k35

View 1k35 on RCSB PDB site
Description: Crystal Structure of Phosphomannomutase/Phosphoglucomutase from P.aeruginosa
Class: Isomerase
Keywords: alpha/beta protein, phosphoserine, enzyme-metal complex, Isomerase
Deposited on 2001-10-01, released 2002-02-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.238
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phosphomannomutase
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: AlgC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P26276 (Start-462)
      • modified residue (83)
      • modified residue (103)
      • modified residue (107)
      • modified residue (168)
      • modified residue (172)
      • modified residue (264)
      • modified residue (302)
      • modified residue (314)
      • modified residue (325)
    Domains in SCOPe 2.08: d1k35a1, d1k35a2, d1k35a3, d1k35a4
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1k35A (A:)
    mstakaptlpasifraydirgvvgdtltaetaywigraigseslargepcvavgrdgrls
    gpelvkqliqglvdcgcqvsdvgmvptpvlyyaanvlegksgvmltgshnppdyngfkiv
    vagetlaneqiqalreriekndlasgvgsveqvdilpryfkqirddiamakpmkvvvdcg
    ngvagviapqliealgcsviplycevdgnfpnhhpdpgkpenlkdliakvkaenadlgla
    fdgdgdrvgvvtntgtiiypdrllmlfakdvvsrnpgadiifdvkctrrlialisgyggr
    pvmwktghslikkkmketgallagemsghvffkerwfgfddgiysaarlleilsqdqrds
    ehvfsafpsdistpeinitvtedskfaiiealqrdaqwgegnittldgvrvdypkgwglv
    rasnttpvlvlrfeadteeeleriktvfrnqlkavdsslpvpf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1k35A (A:)
    lpasifraydirgvvgdtltaetaywigraigseslargepcvavgrdgrlsgpelvkql
    iqglvdcgcqvsdvgmvptpvlyyaanvlegksgvmltgshnppdyngfkivvagetlan
    eqiqalreriekndlasgvgsveqvdilpryfkqirddiamakpmkvvvdcgngvagvia
    pqliealgcsviplycevdgnfpnhhpdpgkpenlkdliakvkaenadlglafdgdgdrv
    gvvtntgtiiypdrllmlfakdvvsrnpgadiifdvkctrrlialisgyggrpvmwktgh
    slikkkmketgallagemsghvffkerwfgfddgiysaarlleilsqdqrdsehvfsafp
    sdistpeinitvtedskfaiiealqrdaqwgegnittldgvrvdypkgwglvrasnttpv
    lvlrfeadteeeleriktvfrnqlkavdsslpvpf