PDB entry 1k32

View 1k32 on RCSB PDB site
Description: Crystal structure of the tricorn protease
Class: hydrolase
Keywords: protein degradation, substrate gating, serine protease, beta propeller, proteasome, HYDROLASE
Deposited on 2001-10-01, released 2001-12-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.245
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1k32A (A:)
    ktfklhemhglcmpnlllnpdihgdriifvccddlwehdlksgstrkivsnlgvinnarf
    fpdgrkiairvmrgsslntadlyfyngengeikrityfsgkstgrrmftdvagfdpdgnl
    iistdamqpfssmtclyrvendginfvplnlgpathilfadgrrvigrntfelphwkgyr
    ggtrgkiwievnsgafkkivdmsthvsspvivghriyfitdidgfgqiystdldgkdlrk
    htsftdyyprhlntdgrrilfskggsiyifnpdtekiekieigdlespedriisipskfa
    edfspldgdliafvsrgqafiqdvsgtyvlkvpeplriryvrrggdtkvafihgtregdf
    lgiydyrtgkaekfeenlgnvfamgvdrngkfavvandrfeimtvdletgkptviersre
    amitdftisdnsrfiaygfplkhgetdgyvmqaihvydmegrkifaattenshdyapafd
    adsknlyylsyrsldpspdrvvlnfsfevvskpfviplipgspnptklvprsmtseagey
    dlndmykrsspinvdpgdyrmiiplessiliysvpvhgefaayyqgapekgvllkydvkt
    rkvtevknnltdlrlsadrktvmvrkddgkiytfplekpedertvetdkrplvssiheef
    lqmydeawklardnywneavakeiseriyekyrnlvplcktrydlsnvivemqgeyrtsh
    syemggtftdkdpfrsgriacdfkldgdhyvvakayagdysnegekspifeygidptgyl
    iedidgetvgagsniyrvlsekagtsarirlsgkggdkrdlmidildddrfiryrswvea
    nrryvherskgtigyihipdmgmmglnefyrlfinessyqglivdvrfngggfvsqliie
    klmnkrigydnprrgtlspyptnsvrgkiiaitneyagsdgdifsfsfkklglgkligtr
    twggvvgitpkrrlidgtvltqpefafwfrdagfgvenygvdpdveieyaphdylsgkdp
    qidyaidalieelrnwneelpqrps
    

    Sequence, based on observed residues (ATOM records): (download)
    >1k32A (A:)
    mpnlllnpdihgdriifvccddlwehdlksgstrkivsnlgvinnarffpdgrkiairvm
    rgsslntadlyfyngengeikrityfsgkstgrrmftdvagfdpdgnliistdamqpfss
    mtclyrvendginfvplnlgpathilfadgrrvigrntfelphwkgyrggtrgkiwievn
    sgafkkivdmsthvsspvivghriyfitdidgfgqiystdldgkdlrkhtsftdyyprhl
    ntdgrrilfskggsiyifnpdtekiekieigdlespedriisipskfaedfspldgdlia
    fvsrgqafiqdvsgtyvlkvpeplriryvrrggdtkvafihgtregdflgiydyrtgkae
    kfeenlgnvfamgvdrngkfavvandrfeimtvdletgkptviersreamitdftisdns
    rfiaygfplkhgetdgyvmqaihvydmegrkifaattenshdyapafdadsknlyylsyr
    sldpspdrvvlnfsfevvskpfviplipgspnptklvprsmtseageydlndmykrsspi
    nvdpgdyrmiiplessiliysvpvhgefaayyqgapekgvllkydvktrkvtevknnltd
    lrlsadrktvmvrkddgkiytfplekpedertvetdkrplvssiheeflqmydeawklar
    dnywneavakeiseriyekyrnlvplcktrydlsnvivemqgeyrtshsyemggtftdkd
    pfrsgriacdfkldgdhyvvakayagdysnegekspifeygidptgyliedidgetvgag
    sniyrvlsekagtsarirlsgkggdkrdlmidildddrfiryrswveanrryvherskgt
    igyihipdmgmmglnefyrlfinessyqglivdvrfngggfvsqliieklmnkrigydnp
    rrgtlspyptnsvrgkiiaitneyagsdgdifsfsfkklglgkligtrtwggvvgitpkr
    rlidgtvltqpefafwfrdagfgvenygvdpdveieyaphdylsgkdpqidyaidaliee
    lrn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1k32B (B:)
    ktfklhemhglcmpnlllnpdihgdriifvccddlwehdlksgstrkivsnlgvinnarf
    fpdgrkiairvmrgsslntadlyfyngengeikrityfsgkstgrrmftdvagfdpdgnl
    iistdamqpfssmtclyrvendginfvplnlgpathilfadgrrvigrntfelphwkgyr
    ggtrgkiwievnsgafkkivdmsthvsspvivghriyfitdidgfgqiystdldgkdlrk
    htsftdyyprhlntdgrrilfskggsiyifnpdtekiekieigdlespedriisipskfa
    edfspldgdliafvsrgqafiqdvsgtyvlkvpeplriryvrrggdtkvafihgtregdf
    lgiydyrtgkaekfeenlgnvfamgvdrngkfavvandrfeimtvdletgkptviersre
    amitdftisdnsrfiaygfplkhgetdgyvmqaihvydmegrkifaattenshdyapafd
    adsknlyylsyrsldpspdrvvlnfsfevvskpfviplipgspnptklvprsmtseagey
    dlndmykrsspinvdpgdyrmiiplessiliysvpvhgefaayyqgapekgvllkydvkt
    rkvtevknnltdlrlsadrktvmvrkddgkiytfplekpedertvetdkrplvssiheef
    lqmydeawklardnywneavakeiseriyekyrnlvplcktrydlsnvivemqgeyrtsh
    syemggtftdkdpfrsgriacdfkldgdhyvvakayagdysnegekspifeygidptgyl
    iedidgetvgagsniyrvlsekagtsarirlsgkggdkrdlmidildddrfiryrswvea
    nrryvherskgtigyihipdmgmmglnefyrlfinessyqglivdvrfngggfvsqliie
    klmnkrigydnprrgtlspyptnsvrgkiiaitneyagsdgdifsfsfkklglgkligtr
    twggvvgitpkrrlidgtvltqpefafwfrdagfgvenygvdpdveieyaphdylsgkdp
    qidyaidalieelrnwneelpqrps
    

    Sequence, based on observed residues (ATOM records): (download)
    >1k32B (B:)
    mpnlllnpdihgdriifvccddlwehdlksgstrkivsnlgvinnarffpdgrkiairvm
    rgsslntadlyfyngengeikrityfsgkstgrrmftdvagfdpdgnliistdamqpfss
    mtclyrvendginfvplnlgpathilfadgrrvigrntfelphwkgyrggtrgkiwievn
    sgafkkivdmsthvsspvivghriyfitdidgfgqiystdldgkdlrkhtsftdyyprhl
    ntdgrrilfskggsiyifnpdtekiekieigdlespedriisipskfaedfspldgdlia
    fvsrgqafiqdvsgtyvlkvpeplriryvrrggdtkvafihgtregdflgiydyrtgkae
    kfeenlgnvfamgvdrngkfavvandrfeimtvdletgkptviersreamitdftisdns
    rfiaygfplkhgetdgyvmqaihvydmegrkifaattenshdyapafdadsknlyylsyr
    sldpspdrvvlnfsfevvskpfviplipgspnptklvprsmtseageydlndmykrsspi
    nvdpgdyrmiiplessiliysvpvhgefaayyqgapekgvllkydvktrkvtevknnltd
    lrlsadrktvmvrkddgkiytfplekpedertvetdkrplvssiheeflqmydeawklar
    dnywneavakeiseriyekyrnlvplcktrydlsnvivemqgeyrtshsyemggtftdkd
    pfrsgriacdfkldgdhyvvakayagdysnegekspifeygidptgyliedidgetvgag
    sniyrvlsekagtsarirlsgkggdkrdlmidildddrfiryrswveanrryvherskgt
    igyihipdmgmmglnefyrlfinessyqglivdvrfngggfvsqliieklmnkrigydnp
    rrgtlspyptnsvrgkiiaitneyagsdgdifsfsfkklglgkligtrtwggvvgitpkr
    rlidgtvltqpefafwfrdagfgvenygvdpdveieyaphdylsgkdpqidyaidaliee
    lrn
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1k32C (C:)
    ktfklhemhglcmpnlllnpdihgdriifvccddlwehdlksgstrkivsnlgvinnarf
    fpdgrkiairvmrgsslntadlyfyngengeikrityfsgkstgrrmftdvagfdpdgnl
    iistdamqpfssmtclyrvendginfvplnlgpathilfadgrrvigrntfelphwkgyr
    ggtrgkiwievnsgafkkivdmsthvsspvivghriyfitdidgfgqiystdldgkdlrk
    htsftdyyprhlntdgrrilfskggsiyifnpdtekiekieigdlespedriisipskfa
    edfspldgdliafvsrgqafiqdvsgtyvlkvpeplriryvrrggdtkvafihgtregdf
    lgiydyrtgkaekfeenlgnvfamgvdrngkfavvandrfeimtvdletgkptviersre
    amitdftisdnsrfiaygfplkhgetdgyvmqaihvydmegrkifaattenshdyapafd
    adsknlyylsyrsldpspdrvvlnfsfevvskpfviplipgspnptklvprsmtseagey
    dlndmykrsspinvdpgdyrmiiplessiliysvpvhgefaayyqgapekgvllkydvkt
    rkvtevknnltdlrlsadrktvmvrkddgkiytfplekpedertvetdkrplvssiheef
    lqmydeawklardnywneavakeiseriyekyrnlvplcktrydlsnvivemqgeyrtsh
    syemggtftdkdpfrsgriacdfkldgdhyvvakayagdysnegekspifeygidptgyl
    iedidgetvgagsniyrvlsekagtsarirlsgkggdkrdlmidildddrfiryrswvea
    nrryvherskgtigyihipdmgmmglnefyrlfinessyqglivdvrfngggfvsqliie
    klmnkrigydnprrgtlspyptnsvrgkiiaitneyagsdgdifsfsfkklglgkligtr
    twggvvgitpkrrlidgtvltqpefafwfrdagfgvenygvdpdveieyaphdylsgkdp
    qidyaidalieelrnwneelpqrps
    

    Sequence, based on observed residues (ATOM records): (download)
    >1k32C (C:)
    mpnlllnpdihgdriifvccddlwehdlksgstrkivsnlgvinnarffpdgrkiairvm
    rgsslntadlyfyngengeikrityfsgkstgrrmftdvagfdpdgnliistdamqpfss
    mtclyrvendginfvplnlgpathilfadgrrvigrntfelphwkgyrggtrgkiwievn
    sgafkkivdmsthvsspvivghriyfitdidgfgqiystdldgkdlrkhtsftdyyprhl
    ntdgrrilfskggsiyifnpdtekiekieigdlespedriisipskfaedfspldgdlia
    fvsrgqafiqdvsgtyvlkvpeplriryvrrggdtkvafihgtregdflgiydyrtgkae
    kfeenlgnvfamgvdrngkfavvandrfeimtvdletgkptviersreamitdftisdns
    rfiaygfplkhgetdgyvmqaihvydmegrkifaattenshdyapafdadsknlyylsyr
    sldpspdrvvlnfsfevvskpfviplipgspnptklvprsmtseageydlndmykrsspi
    nvdpgdyrmiiplessiliysvpvhgefaayyqgapekgvllkydvktrkvtevknnltd
    lrlsadrktvmvrkddgkiytfplekpedertvetdkrplvssiheeflqmydeawklar
    dnywneavakeiseriyekyrnlvplcktrydlsnvivemqgeyrtshsyemggtftdkd
    pfrsgriacdfkldgdhyvvakayagdysnegekspifeygidptgyliedidgetvgag
    sniyrvlsekagtsarirlsgkggdkrdlmidildddrfiryrswveanrryvherskgt
    igyihipdmgmmglnefyrlfinessyqglivdvrfngggfvsqliieklmnkrigydnp
    rrgtlspyptnsvrgkiiaitneyagsdgdifsfsfkklglgkligtrtwggvvgitpkr
    rlidgtvltqpefafwfrdagfgvenygvdpdveieyaphdylsgkdpqidyaidaliee
    lrn
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1k32D (D:)
    ktfklhemhglcmpnlllnpdihgdriifvccddlwehdlksgstrkivsnlgvinnarf
    fpdgrkiairvmrgsslntadlyfyngengeikrityfsgkstgrrmftdvagfdpdgnl
    iistdamqpfssmtclyrvendginfvplnlgpathilfadgrrvigrntfelphwkgyr
    ggtrgkiwievnsgafkkivdmsthvsspvivghriyfitdidgfgqiystdldgkdlrk
    htsftdyyprhlntdgrrilfskggsiyifnpdtekiekieigdlespedriisipskfa
    edfspldgdliafvsrgqafiqdvsgtyvlkvpeplriryvrrggdtkvafihgtregdf
    lgiydyrtgkaekfeenlgnvfamgvdrngkfavvandrfeimtvdletgkptviersre
    amitdftisdnsrfiaygfplkhgetdgyvmqaihvydmegrkifaattenshdyapafd
    adsknlyylsyrsldpspdrvvlnfsfevvskpfviplipgspnptklvprsmtseagey
    dlndmykrsspinvdpgdyrmiiplessiliysvpvhgefaayyqgapekgvllkydvkt
    rkvtevknnltdlrlsadrktvmvrkddgkiytfplekpedertvetdkrplvssiheef
    lqmydeawklardnywneavakeiseriyekyrnlvplcktrydlsnvivemqgeyrtsh
    syemggtftdkdpfrsgriacdfkldgdhyvvakayagdysnegekspifeygidptgyl
    iedidgetvgagsniyrvlsekagtsarirlsgkggdkrdlmidildddrfiryrswvea
    nrryvherskgtigyihipdmgmmglnefyrlfinessyqglivdvrfngggfvsqliie
    klmnkrigydnprrgtlspyptnsvrgkiiaitneyagsdgdifsfsfkklglgkligtr
    twggvvgitpkrrlidgtvltqpefafwfrdagfgvenygvdpdveieyaphdylsgkdp
    qidyaidalieelrnwneelpqrps
    

    Sequence, based on observed residues (ATOM records): (download)
    >1k32D (D:)
    mpnlllnpdihgdriifvccddlwehdlksgstrkivsnlgvinnarffpdgrkiairvm
    rgsslntadlyfyngengeikrityfsgkstgrrmftdvagfdpdgnliistdamqpfss
    mtclyrvendginfvplnlgpathilfadgrrvigrntfelphwkgyrggtrgkiwievn
    sgafkkivdmsthvsspvivghriyfitdidgfgqiystdldgkdlrkhtsftdyyprhl
    ntdgrrilfskggsiyifnpdtekiekieigdlespedriisipskfaedfspldgdlia
    fvsrgqafiqdvsgtyvlkvpeplriryvrrggdtkvafihgtregdflgiydyrtgkae
    kfeenlgnvfamgvdrngkfavvandrfeimtvdletgkptviersreamitdftisdns
    rfiaygfplkhgetdgyvmqaihvydmegrkifaattenshdyapafdadsknlyylsyr
    sldpspdrvvlnfsfevvskpfviplipgspnptklvprsmtseageydlndmykrsspi
    nvdpgdyrmiiplessiliysvpvhgefaayyqgapekgvllkydvktrkvtevknnltd
    lrlsadrktvmvrkddgkiytfplekpedertvetdkrplvssiheeflqmydeawklar
    dnywneavakeiseriyekyrnlvplcktrydlsnvivemqgeyrtshsyemggtftdkd
    pfrsgriacdfkldgdhyvvakayagdysnegekspifeygidptgyliedidgetvgag
    sniyrvlsekagtsarirlsgkggdkrdlmidildddrfiryrswveanrryvherskgt
    igyihipdmgmmglnefyrlfinessyqglivdvrfngggfvsqliieklmnkrigydnp
    rrgtlspyptnsvrgkiiaitneyagsdgdifsfsfkklglgkligtrtwggvvgitpkr
    rlidgtvltqpefafwfrdagfgvenygvdpdveieyaphdylsgkdpqidyaidaliee
    lrn
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1k32E (E:)
    ktfklhemhglcmpnlllnpdihgdriifvccddlwehdlksgstrkivsnlgvinnarf
    fpdgrkiairvmrgsslntadlyfyngengeikrityfsgkstgrrmftdvagfdpdgnl
    iistdamqpfssmtclyrvendginfvplnlgpathilfadgrrvigrntfelphwkgyr
    ggtrgkiwievnsgafkkivdmsthvsspvivghriyfitdidgfgqiystdldgkdlrk
    htsftdyyprhlntdgrrilfskggsiyifnpdtekiekieigdlespedriisipskfa
    edfspldgdliafvsrgqafiqdvsgtyvlkvpeplriryvrrggdtkvafihgtregdf
    lgiydyrtgkaekfeenlgnvfamgvdrngkfavvandrfeimtvdletgkptviersre
    amitdftisdnsrfiaygfplkhgetdgyvmqaihvydmegrkifaattenshdyapafd
    adsknlyylsyrsldpspdrvvlnfsfevvskpfviplipgspnptklvprsmtseagey
    dlndmykrsspinvdpgdyrmiiplessiliysvpvhgefaayyqgapekgvllkydvkt
    rkvtevknnltdlrlsadrktvmvrkddgkiytfplekpedertvetdkrplvssiheef
    lqmydeawklardnywneavakeiseriyekyrnlvplcktrydlsnvivemqgeyrtsh
    syemggtftdkdpfrsgriacdfkldgdhyvvakayagdysnegekspifeygidptgyl
    iedidgetvgagsniyrvlsekagtsarirlsgkggdkrdlmidildddrfiryrswvea
    nrryvherskgtigyihipdmgmmglnefyrlfinessyqglivdvrfngggfvsqliie
    klmnkrigydnprrgtlspyptnsvrgkiiaitneyagsdgdifsfsfkklglgkligtr
    twggvvgitpkrrlidgtvltqpefafwfrdagfgvenygvdpdveieyaphdylsgkdp
    qidyaidalieelrnwneelpqrps
    

    Sequence, based on observed residues (ATOM records): (download)
    >1k32E (E:)
    mpnlllnpdihgdriifvccddlwehdlksgstrkivsnlgvinnarffpdgrkiairvm
    rgsslntadlyfyngengeikrityfsgkstgrrmftdvagfdpdgnliistdamqpfss
    mtclyrvendginfvplnlgpathilfadgrrvigrntfelphwkgyrggtrgkiwievn
    sgafkkivdmsthvsspvivghriyfitdidgfgqiystdldgkdlrkhtsftdyyprhl
    ntdgrrilfskggsiyifnpdtekiekieigdlespedriisipskfaedfspldgdlia
    fvsrgqafiqdvsgtyvlkvpeplriryvrrggdtkvafihgtregdflgiydyrtgkae
    kfeenlgnvfamgvdrngkfavvandrfeimtvdletgkptviersreamitdftisdns
    rfiaygfplkhgetdgyvmqaihvydmegrkifaattenshdyapafdadsknlyylsyr
    sldpspdrvvlnfsfevvskpfviplipgspnptklvprsmtseageydlndmykrsspi
    nvdpgdyrmiiplessiliysvpvhgefaayyqgapekgvllkydvktrkvtevknnltd
    lrlsadrktvmvrkddgkiytfplekpedertvetdkrplvssiheeflqmydeawklar
    dnywneavakeiseriyekyrnlvplcktrydlsnvivemqgeyrtshsyemggtftdkd
    pfrsgriacdfkldgdhyvvakayagdysnegekspifeygidptgyliedidgetvgag
    sniyrvlsekagtsarirlsgkggdkrdlmidildddrfiryrswveanrryvherskgt
    igyihipdmgmmglnefyrlfinessyqglivdvrfngggfvsqliieklmnkrigydnp
    rrgtlspyptnsvrgkiiaitneyagsdgdifsfsfkklglgkligtrtwggvvgitpkr
    rlidgtvltqpefafwfrdagfgvenygvdpdveieyaphdylsgkdpqidyaidaliee
    lrn
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1k32F (F:)
    ktfklhemhglcmpnlllnpdihgdriifvccddlwehdlksgstrkivsnlgvinnarf
    fpdgrkiairvmrgsslntadlyfyngengeikrityfsgkstgrrmftdvagfdpdgnl
    iistdamqpfssmtclyrvendginfvplnlgpathilfadgrrvigrntfelphwkgyr
    ggtrgkiwievnsgafkkivdmsthvsspvivghriyfitdidgfgqiystdldgkdlrk
    htsftdyyprhlntdgrrilfskggsiyifnpdtekiekieigdlespedriisipskfa
    edfspldgdliafvsrgqafiqdvsgtyvlkvpeplriryvrrggdtkvafihgtregdf
    lgiydyrtgkaekfeenlgnvfamgvdrngkfavvandrfeimtvdletgkptviersre
    amitdftisdnsrfiaygfplkhgetdgyvmqaihvydmegrkifaattenshdyapafd
    adsknlyylsyrsldpspdrvvlnfsfevvskpfviplipgspnptklvprsmtseagey
    dlndmykrsspinvdpgdyrmiiplessiliysvpvhgefaayyqgapekgvllkydvkt
    rkvtevknnltdlrlsadrktvmvrkddgkiytfplekpedertvetdkrplvssiheef
    lqmydeawklardnywneavakeiseriyekyrnlvplcktrydlsnvivemqgeyrtsh
    syemggtftdkdpfrsgriacdfkldgdhyvvakayagdysnegekspifeygidptgyl
    iedidgetvgagsniyrvlsekagtsarirlsgkggdkrdlmidildddrfiryrswvea
    nrryvherskgtigyihipdmgmmglnefyrlfinessyqglivdvrfngggfvsqliie
    klmnkrigydnprrgtlspyptnsvrgkiiaitneyagsdgdifsfsfkklglgkligtr
    twggvvgitpkrrlidgtvltqpefafwfrdagfgvenygvdpdveieyaphdylsgkdp
    qidyaidalieelrnwneelpqrps
    

    Sequence, based on observed residues (ATOM records): (download)
    >1k32F (F:)
    mpnlllnpdihgdriifvccddlwehdlksgstrkivsnlgvinnarffpdgrkiairvm
    rgsslntadlyfyngengeikrityfsgkstgrrmftdvagfdpdgnliistdamqpfss
    mtclyrvendginfvplnlgpathilfadgrrvigrntfelphwkgyrggtrgkiwievn
    sgafkkivdmsthvsspvivghriyfitdidgfgqiystdldgkdlrkhtsftdyyprhl
    ntdgrrilfskggsiyifnpdtekiekieigdlespedriisipskfaedfspldgdlia
    fvsrgqafiqdvsgtyvlkvpeplriryvrrggdtkvafihgtregdflgiydyrtgkae
    kfeenlgnvfamgvdrngkfavvandrfeimtvdletgkptviersreamitdftisdns
    rfiaygfplkhgetdgyvmqaihvydmegrkifaattenshdyapafdadsknlyylsyr
    sldpspdrvvlnfsfevvskpfviplipgspnptklvprsmtseageydlndmykrsspi
    nvdpgdyrmiiplessiliysvpvhgefaayyqgapekgvllkydvktrkvtevknnltd
    lrlsadrktvmvrkddgkiytfplekpedertvetdkrplvssiheeflqmydeawklar
    dnywneavakeiseriyekyrnlvplcktrydlsnvivemqgeyrtshsyemggtftdkd
    pfrsgriacdfkldgdhyvvakayagdysnegekspifeygidptgyliedidgetvgag
    sniyrvlsekagtsarirlsgkggdkrdlmidildddrfiryrswveanrryvherskgt
    igyihipdmgmmglnefyrlfinessyqglivdvrfngggfvsqliieklmnkrigydnp
    rrgtlspyptnsvrgkiiaitneyagsdgdifsfsfkklglgkligtrtwggvvgitpkr
    rlidgtvltqpefafwfrdagfgvenygvdpdveieyaphdylsgkdpqidyaidaliee
    lrn