PDB entry 1k30

View 1k30 on RCSB PDB site
Description: Crystal Structure Analysis of Squash (Cucurbita moschata) glycerol-3-phosphate (1)-acyltransferase
Class: transferase
Keywords: Four-helix bundle, TRANSFERASE
Deposited on 2001-10-01, released 2001-10-31
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.188
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glycerol-3-phosphate acyltransferase
    Species: Cucurbita moschata [TaxId:3662]
    Gene: PLSB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10349 (3-367)
      • cloning artifact (2)
    Domains in SCOPe 2.06: d1k30a1, d1k30a2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1k30A (A:)
    mashsrkfldvrseeellscikketeagklppnvaagmeelyqnyrnaviesgnpkadei
    vlsnmtvaldrilldvedpfvfsshhkairepfdyyifgqnyirplidfgnsfvgnlslf
    kdieeklqqghnvvlisnhqteadpaiislllektnpyiaentifvagdrvladplckpf
    sigrnlicvyskkhmfdipeltetkrkantrslkemalllrggsqliwiapsggrdrpdp
    stgewypapfdassvdnmrrliqhsdvpghlfplallchdimpppsqveieigekrviaf
    ngaglsvapeisfeeiaathknpeevreayskalfdsvamqynvlktaisgkqglgasta
    dvslsqpw
    

    Sequence, based on observed residues (ATOM records): (download)
    >1k30A (A:)
    shsrkfldvrseeellscikketeagklppnvaagmeelyqnyrnaviesgnpkadeivl
    snmtvaldrilldvedpfvfsshhkairepfdyyifgqnyirplidfgnsfvgnlslfkd
    ieeklqqghnvvlisnhqteadpaiislllektnpyiaentifvagdrvladplckpfsi
    grnlicvyskkhmfdipeltetkrkantrslkemalllrggsqliwiapsggrdrpdpst
    gewypapfdassvdnmrrliqhsdvpghlfplallchdimpppsqveieirviafngagl
    svapeisfeeiaathknpeevreayskalfdsvamqynvlktaisgkqglgastadvsls
    qpw