PDB entry 1k2x

View 1k2x on RCSB PDB site
Description: Crystal structure of putative asparaginase encoded by Escherichia coli ybiK gene
Class: hydrolase
Keywords: Ntn Hydrolase, Asparginase, Autoproteolysis, HYDROLASE
Deposited on 2001-09-30, released 2003-09-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.163
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative L-asparaginase
    Species: Escherichia coli [TaxId:562]
    Gene: ybiK
    Database cross-references and differences (RAF-indexed):
    • Uniprot P37595 (0-End)
      • modified residue (61)
    Domains in SCOPe 2.07: d1k2x.1
  • Chain 'B':
    Compound: Putative L-asparaginase
    Species: Escherichia coli [TaxId:562]
    Gene: ybiK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1k2x.1
  • Chain 'C':
    Compound: Putative L-asparaginase
    Species: Escherichia coli [TaxId:562]
    Gene: ybiK
    Database cross-references and differences (RAF-indexed):
    • Uniprot P37595 (0-End)
      • modified residue (61)
    Domains in SCOPe 2.07: d1k2x.2
  • Chain 'D':
    Compound: Putative L-asparaginase
    Species: Escherichia coli [TaxId:562]
    Gene: ybiK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1k2x.2
  • Heterogens: NA, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1k2xA (A:)
    gkaviaihggagaisraqmslqqelryiealsaivetgqkmleagesaldvvteavrlle
    ecplfnagigavftrdetheldacvmdgntlkagavagvshlrnpvlaarlvmeqsphvm
    migegaenfafargmervspeifstslryeqllaarkegatvldhsgapldekqkmg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1k2xA (A:)
    gkaviaihggagaisraqmslqqelryiealsaivetgqkmleagesaldvvteavrlle
    ecplfnagigavftrdetheldacvmdgntlkagavagvshlrnpvlaarlvmeqsphvm
    migegaenfafargmervspeifstslryeqllaar
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1k2xB (B:)
    tvgavaldldgnlaaatstggmtnklpgrvgdsplvgagcyannasvavsctgtgevfir
    alaaydiaalmdygglslaeacervvmeklpalggsggliaidhegnvalpfntegmyra
    wgyagdtpttgiyrekgdtvatq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1k2xB (B:)
    tvgavaldldgnlaaatstggmtnklpgrvgdsplvgagcyannasvavsctgtgevfir
    alaaydiaalmdygglslaeacervvmeklpalggsggliaidhegnvalpfntegmyra
    wgyagdtpttgiyre
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1k2xC (C:)
    gkaviaihggagaisraqmslqqelryiealsaivetgqkmleagesaldvvteavrlle
    ecplfnagigavftrdetheldacvmdgntlkagavagvshlrnpvlaarlvmeqsphvm
    migegaenfafargmervspeifstslryeqllaarkegatvldhsgapldekqkmg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1k2xC (C:)
    gkaviaihggagaisraqmslqqelryiealsaivetgqkmleagesaldvvteavrlle
    ecplfnagigavftrdetheldacvmdgntlkagavagvshlrnpvlaarlvmeqsphvm
    migegaenfafargmervspeifstslryeqllaar
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1k2xD (D:)
    tvgavaldldgnlaaatstggmtnklpgrvgdsplvgagcyannasvavsctgtgevfir
    alaaydiaalmdygglslaeacervvmeklpalggsggliaidhegnvalpfntegmyra
    wgyagdtpttgiyrekgdtvatq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1k2xD (D:)
    tvgavaldldgnlaaatstggmtnklpgrvgdsplvgagcyannasvavsctgtgevfir
    alaaydiaalmdygglslaeacervvmeklpalggsggliaidhegnvalpfntegmyra
    wgyagdtpttgiyre