PDB entry 1k2w

View 1k2w on RCSB PDB site
Description: crystal structure of sorbitol dehydrogenase from r. sphaeroides
Deposited on 2001-09-29, released 2003-11-11
The last revision prior to the SCOP 1.67 freeze date was dated 2003-11-11, with a file datestamp of 2003-11-11.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.188
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1k2wa_
  • Chain 'B':
    Domains in SCOP 1.67: d1k2wb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1k2wA (A:)
    mrldgktalitgsargigrafaeayvregarvaiadinleaarataaeigpaacaialdv
    tdqasidrcvaelldrwgsidilvnnaalfdlapiveitresydrlfainvsgtlfmmqa
    varamiaggrggkiinmasqagrrgealvgvycatkaavisltqsaglnlirhginvnai
    apgvvdgehwdgvdakfadyenlprgekkrqvgaavpfgrmgraedltgmaiflatpead
    yivaqtynvdggnwms
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1k2wB (B:)
    mrldgktalitgsargigrafaeayvregarvaiadinleaarataaeigpaacaialdv
    tdqasidrcvaelldrwgsidilvnnaalfdlapiveitresydrlfainvsgtlfmmqa
    varamiaggrggkiinmasqagrrgealvgvycatkaavisltqsaglnlirhginvnai
    apgvvdgehwdgvdakfadyenlprgekkrqvgaavpfgrmgraedltgmaiflatpead
    yivaqtynvdggnwms