PDB entry 1k2w

View 1k2w on RCSB PDB site
Description: Crystal structure of sorbitol dehydrogenase from R. sphaeroides
Class: oxidoreductase
Keywords: short-chain dehydrogenase, enzyme, OXIDOREDUCTASE
Deposited on 2001-09-29, released 2003-11-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: sorbitol dehydrogenase
    Species: Rhodobacter sphaeroides [TaxId:1063]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1k2wa_
  • Chain 'B':
    Compound: sorbitol dehydrogenase
    Species: Rhodobacter sphaeroides [TaxId:1063]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1k2wb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1k2wA (A:)
    mrldgktalitgsargigrafaeayvregarvaiadinleaarataaeigpaacaialdv
    tdqasidrcvaelldrwgsidilvnnaalfdlapiveitresydrlfainvsgtlfmmqa
    varamiaggrggkiinmasqagrrgealvgvycatkaavisltqsaglnlirhginvnai
    apgvvdgehwdgvdakfadyenlprgekkrqvgaavpfgrmgraedltgmaiflatpead
    yivaqtynvdggnwms
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1k2wB (B:)
    mrldgktalitgsargigrafaeayvregarvaiadinleaarataaeigpaacaialdv
    tdqasidrcvaelldrwgsidilvnnaalfdlapiveitresydrlfainvsgtlfmmqa
    varamiaggrggkiinmasqagrrgealvgvycatkaavisltqsaglnlirhginvnai
    apgvvdgehwdgvdakfadyenlprgekkrqvgaavpfgrmgraedltgmaiflatpead
    yivaqtynvdggnwms