PDB entry 1k2o

View 1k2o on RCSB PDB site
Description: cytochrome p450cam with bound bis(2,2'-bipyridine)-(5-methyl-2-2'- bipyridine)-c2-adamantane ruthenium (ii)
Deposited on 2001-09-28, released 2001-10-17
The last revision prior to the SCOP 1.63 freeze date was dated 2001-10-24, with a file datestamp of 2001-10-24.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.21
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.63: d1k2oa_
  • Chain 'B':
    Domains in SCOP 1.63: d1k2ob_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1k2oA (A:)
    anlaplpphvpehlvfdfdmynpsnlsagvqeawavlqesnvpdlvwtrcngghwiatrg
    qlireayedyrhfssecpfipreageaydfiptsmdppeqrqfralanqvvgmpvvdkle
    nriqelacslieslrpqgqcnftedyaepfpirifmllaglpeediphlkyltdqmtrpd
    gsmtfaeakealydylipiieqrrqkpgtdaisivangqvngrpitsdeakrmcglllvg
    gldtvvnflsfsmeflakspehrqelierperipaaceellrrfslvadgriltsdyefh
    gvqlkkgdqillpqmlsglderenaapmhvdfsrqkvshttfghgshlclgqhlarreii
    vtlkewltripdfsiapgaqiqhksgivsgvqalplvwdpattkav
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1k2oB (B:)
    anlaplpphvpehlvfdfdmynpsnlsagvqeawavlqesnvpdlvwtrcngghwiatrg
    qlireayedyrhfssecpfipreageaydfiptsmdppeqrqfralanqvvgmpvvdkle
    nriqelacslieslrpqgqcnftedyaepfpirifmllaglpeediphlkyltdqmtrpd
    gsmtfaeakealydylipiieqrrqkpgtdaisivangqvngrpitsdeakrmcglllvg
    gldtvvnflsfsmeflakspehrqelierperipaaceellrrfslvadgriltsdyefh
    gvqlkkgdqillpqmlsglderenaapmhvdfsrqkvshttfghgshlclgqhlarreii
    vtlkewltripdfsiapgaqiqhksgivsgvqalplvwdpattkav