PDB entry 1k2n

View 1k2n on RCSB PDB site
Description: Solution Structure of the FHA2 domain of Rad53 Complexed with a Phosphothreonyl Peptide Derived from Rad9
Class: transferase
Keywords: FHA domain, Rad53, Rad9, Phosphothreonine, Phosphoprotein, TRANSFERASE
Deposited on 2001-09-28, released 2001-12-05
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein kinase spk1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: SPK1 or Rad53
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1k2na_
  • Chain 'P':
    Compound: DNA repair protein rad9
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14737 (0-8)
      • modified residue (4)

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1k2nA (A:)
    gngrfltlkplpdsiiqesleiqqgvnpffigrsedcnckiednrlsrvhcfifkkrhav
    gksmyespaqglddiwychtgtnvsylnnnrmiqgtkfllqdgdeikiiwdknnkfvigf
    kveindttglfneglgmlqeqrvvlkqtaeekdlvkkl
    

  • Chain 'P':
    No sequence available.