PDB entry 1k2i

View 1k2i on RCSB PDB site
Description: Crystal Structure of Gamma-Chymotrypsin in Complex with 7-Hydroxycoumarin
Class: hydrolase
Keywords: enzyme-inhibitor complex, hydrolase
Deposited on 2001-09-27, released 2001-12-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.18
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain '1':
    Compound: chymotrypsinogen a
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1k2i1_
  • Heterogens: SO4, SN1, HOH

PDB Chain Sequences:

  • Chain '1':
    Sequence, based on SEQRES records: (download)
    >1k2i1 (1:)
    cgvpaiqpvlsglsrivngeeavpgswpwqvslqdktgfhfcggslinenwvvtaahcgv
    ttsdvvvagefdqgsssekiqklkiakvfknskynsltinnditllklstaasfsqtvsa
    vclpsasddfaagttcvttgwgltrytnantpdrlqqaslpllsntnckkywgtkikdam
    icagasgvsscmgdsggplvckkngawtlvgivswgsstcststpgvyarvtalvnwvqq
    tlaan
    

    Sequence, based on observed residues (ATOM records): (download)
    >1k2i1 (1:)
    cgvpaiqpvlivngeeavpgswpwqvslqdktgfhfcggslinenwvvtaahcgvttsdv
    vvagefdqgsssekiqklkiakvfknskynsltinnditllklstaasfsqtvsavclps
    asddfaagttcvttgwgltrytpdrlqqaslpllsntnckkywgtkikdamicagasgvs
    scmgdsggplvckkngawtlvgivswgsstcststpgvyarvtalvnwvqqtlaan