PDB entry 1k2h

View 1k2h on RCSB PDB site
Description: Three-dimensional Solution Structure of apo-S100A1.
Class: metal binding protein
Keywords: Non-covalent homodimer, X-type four-helix bundle, METAL BINDING PROTEIN
Deposited on 2001-09-27, released 2002-02-13
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: S-100 protein, alpha chain
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1k2ha_
  • Chain 'B':
    Compound: S-100 protein, alpha chain
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1k2hb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1k2hA (A:)
    gseletametlinvfhahsgkegdkyklskkelkdllqtelssfldvqkdadavdkimke
    ldengdgevdfqefvvlvaaltvacnnffwens
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1k2hB (B:)
    gseletametlinvfhahsgkegdkyklskkelkdllqtelssfldvqkdadavdkimke
    ldengdgevdfqefvvlvaaltvacnnffwens