PDB entry 1k2h
View 1k2h on RCSB PDB site
Description: Three-dimensional Solution Structure of apo-S100A1.
Class: metal binding protein
Keywords: Non-covalent homodimer, X-type four-helix bundle, METAL BINDING PROTEIN
Deposited on
2001-09-27, released
2002-02-13
The last revision prior to the SCOPe 2.03 freeze date was dated
2009-02-24, with a file datestamp of
2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: S-100 protein, alpha chain
Species: Rattus norvegicus [TaxId:10116]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.03: d1k2ha_ - Chain 'B':
Compound: S-100 protein, alpha chain
Species: Rattus norvegicus [TaxId:10116]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.03: d1k2hb_
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>1k2hA (A:)
gseletametlinvfhahsgkegdkyklskkelkdllqtelssfldvqkdadavdkimke
ldengdgevdfqefvvlvaaltvacnnffwens
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>1k2hB (B:)
gseletametlinvfhahsgkegdkyklskkelkdllqtelssfldvqkdadavdkimke
ldengdgevdfqefvvlvaaltvacnnffwens