PDB entry 1k2e

View 1k2e on RCSB PDB site
Description: crystal structure of a nudix protein from Pyrobaculum aerophilum
Deposited on 2001-09-26, released 2002-04-03
The last revision prior to the SCOP 1.63 freeze date was dated 2002-04-03, with a file datestamp of 2002-04-03.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.184
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.63: d1k2ea_
  • Chain 'B':
    Domains in SCOP 1.63: d1k2eb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1k2eA (A:)
    mivtsgvlvengkvllvkhkrlgvyiypgghvehnetpieavkrefeeetgivvepigft
    ygiidenaverpmplvileevvkypeethihfdliylvkrvggdlkngewidvreidrie
    tfpnvrkvvslalstlyrlgkisklaaalehh
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1k2eB (B:)
    mivtsgvlvengkvllvkhkrlgvyiypgghvehnetpieavkrefeeetgivvepigft
    ygiidenaverpmplvileevvkypeethihfdliylvkrvggdlkngewidvreidrie
    tfpnvrkvvslalstlyrlgkisklaaale