PDB entry 1k2e

View 1k2e on RCSB PDB site
Description: crystal structure of a nudix protein from Pyrobaculum aerophilum
Class: structural genomics, unknown function
Keywords: Nudix/MutT-like fold, Mixed alpha/beta, dimer, putative Nudix hydrolase, STRUCTURAL GENOMICS, UNKNOWN FUNCTION
Deposited on 2001-09-26, released 2002-04-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.184
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nudix homolog
    Species: Pyrobaculum aerophilum [TaxId:13773]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1k2ea1, d1k2ea2
  • Chain 'B':
    Compound: Nudix homolog
    Species: Pyrobaculum aerophilum [TaxId:13773]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1k2eb1, d1k2eb2
  • Heterogens: SO4, NI, GOL, ACY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1k2eA (A:)
    mivtsgvlvengkvllvkhkrlgvyiypgghvehnetpieavkrefeeetgivvepigft
    ygiidenaverpmplvileevvkypeethihfdliylvkrvggdlkngewidvreidrie
    tfpnvrkvvslalstlyrlgkisklaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1k2eA (A:)
    mivtsgvlvengkvllvkhkrlgvyiypgghvehnetpieavkrefeeetgivvepigft
    ygiidenaverpmplvileevvkypeethihfdliylvkrvggdlkngewidvreidrie
    tfpnvrkvvslalstlyrlgkisklaaalehh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1k2eB (B:)
    mivtsgvlvengkvllvkhkrlgvyiypgghvehnetpieavkrefeeetgivvepigft
    ygiidenaverpmplvileevvkypeethihfdliylvkrvggdlkngewidvreidrie
    tfpnvrkvvslalstlyrlgkisklaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1k2eB (B:)
    mivtsgvlvengkvllvkhkrlgvyiypgghvehnetpieavkrefeeetgivvepigft
    ygiidenaverpmplvileevvkypeethihfdliylvkrvggdlkngewidvreidrie
    tfpnvrkvvslalstlyrlgkisklaaale