PDB entry 1k2d

View 1k2d on RCSB PDB site
Description: Crystal structure of the autoimmune MHC class II I-Au complexed with myelin basic protein 1-11 at 2.2A
Class: immune system
Keywords: MHC class II, I-Au, H-2u, autoimmune disease, unique register, experimental autoimmune encephalomyelitis, myelin basic protein, IMMUNE SYSTEM
Deposited on 2001-09-26, released 2003-03-04
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.248
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: H-2 class II histocompatibility antigen, A-U alpha chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14438 (10-188)
      • cloning artifact (7-9)
    Domains in SCOPe 2.05: d1k2da1, d1k2da2
  • Chain 'B':
    Compound: H-2 class II histocompatibility antigen, A-U beta chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1k2db1, d1k2db2
  • Chain 'P':
    Compound: Myelin Basic Protein peptide with 8 residue linker peptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • GB XP_040888 (4-End)
      • cloning artifact (1-3)
      • conflict (4)
  • Heterogens: NDG, NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1k2dA (A:)
    hsrgeddieadhvgsygivvyqspgdigqytfefdgdelfyvdldkketiwmlpefaqlr
    sfdpqgglqniatgkhnlgvltkrsnstpatneapqatvfpkspvllgqpntlicfvdni
    fppvinitwlrnsksvadgvyetsffvnrdysfhklsyltfipsdddiydckvehwglee
    pvlkhwepe
    

    Sequence, based on observed residues (ATOM records): (download)
    >1k2dA (A:)
    ieadhvgsygivvyqspgdigqytfefdgdelfyvdldkketiwmlpefaqlrsfdpqgg
    lqniatgkhnlgvltkrsnstpatneapqatvfpkspvllgqpntlicfvdnifppvini
    twlrnsksvadgvyetsffvnrdysfhklsyltfipsdddiydckvehwgleepvlkhwe
    pe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1k2dB (B:)
    gdserhfvvqfqpfcyftngtqriryvtryiynreeylrfdsdvgeyravtelgrpdaey
    ynkqylertraeldtvcrynyeetevptslrrleqpnvvislsrtealnhhntlvcsvtd
    fypakikvrwfrngqeetvgvsstqlirngdwtfqvlvmlemtprrgevytchvehpslk
    spitvewra
    

    Sequence, based on observed residues (ATOM records): (download)
    >1k2dB (B:)
    rhfvvqfqpfcyftngtqriryvtryiynreeylrfdsdvgeyravtelgrpdaeyynkq
    ylertraeldtvcrynyeetevptslrrleqpnvvislsrtealnhhntlvcsvtdfypa
    kikvrwfrngqeetvgvsstqlirngdwtfqvlvmlemtprrgevytchvehpslkspit
    vewra
    

  • Chain 'P':
    No sequence available.