PDB entry 1k2c
View 1k2c on RCSB PDB site
Description: Combining Mutations in HIV-1 Protease to Understand Mechanisms of Resistance
Class: hydrolase/hydrolase inhibitor
Keywords: hiv-1 protease, hydrolase-hydrolase inhibitor complex
Deposited on
2001-09-26, released
2002-07-10
The last revision prior to the SCOPe 2.04 freeze date was dated
2011-07-13, with a file datestamp of
2011-05-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.201
AEROSPACI score: 0.37
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: protease retropepsin
Species: Human immunodeficiency virus 1 [TaxId:11676]
Database cross-references and differences (RAF-indexed):
- Uniprot P04587 (0-98)
- see remark 999 (6)
- engineered (29)
- see remark 999 (32)
- see remark 999 (62)
- see remark 999 (66)
- engineered (81)
- see remark 999 (94)
Domains in SCOPe 2.04: d1k2ca_ - Chain 'B':
Compound: protease retropepsin
Species: Human immunodeficiency virus 1 [TaxId:11676]
Database cross-references and differences (RAF-indexed):
- Uniprot P04587 (0-98)
- see remark 999 (6)
- engineered (29)
- see remark 999 (32)
- see remark 999 (62)
- see remark 999 (66)
- engineered (81)
- see remark 999 (94)
Domains in SCOPe 2.04: d1k2cb_ - Heterogens: 0Q4, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>1k2cA (A:)
pqitlwkrplvtikiggqlkealldtgadntvieemslpgrwkpkmiggiggfikvrqyd
qiiieiaghkaigtvlvgptpsniigrnlltqigatlnf
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>1k2cB (B:)
pqitlwkrplvtikiggqlkealldtgadntvieemslpgrwkpkmiggiggfikvrqyd
qiiieiaghkaigtvlvgptpsniigrnlltqigatlnf