PDB entry 1k2c

View 1k2c on RCSB PDB site
Description: Combining Mutations in HIV-1 Protease to Understand Mechanisms of Resistance
Class: hydrolase/hydrolase inhibitor
Keywords: hiv-1 protease, hydrolase-hydrolase inhibitor complex
Deposited on 2001-09-26, released 2002-07-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.201
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protease retropepsin
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04587 (0-98)
      • see remark 999 (6)
      • engineered (29)
      • see remark 999 (32)
      • see remark 999 (62)
      • see remark 999 (66)
      • engineered (81)
      • see remark 999 (94)
    Domains in SCOPe 2.08: d1k2ca_
  • Chain 'B':
    Compound: protease retropepsin
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04587 (0-98)
      • see remark 999 (6)
      • engineered (29)
      • see remark 999 (32)
      • see remark 999 (62)
      • see remark 999 (66)
      • engineered (81)
      • see remark 999 (94)
    Domains in SCOPe 2.08: d1k2cb_
  • Heterogens: 0Q4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1k2cA (A:)
    pqitlwkrplvtikiggqlkealldtgadntvieemslpgrwkpkmiggiggfikvrqyd
    qiiieiaghkaigtvlvgptpsniigrnlltqigatlnf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1k2cB (B:)
    pqitlwkrplvtikiggqlkealldtgadntvieemslpgrwkpkmiggiggfikvrqyd
    qiiieiaghkaigtvlvgptpsniigrnlltqigatlnf