PDB entry 1k2a

View 1k2a on RCSB PDB site
Description: Modified Form of Eosinophil-derived Neurotoxin
Class: hydrolase
Keywords: RNase A folding, HYDROLASE
Deposited on 2001-09-26, released 2002-04-03
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1 Å
R-factor: 0.135
AEROSPACI score: 1.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: eosinophil-derived neurotoxin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1k2aa_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1k2aA (A:)
    hvkppqftwaqwfetqhinmtsqqctnamqvinnyqrrcknqntfllttfanvvnvcgnp
    nmtcpsnktrknchhsgsqvplihcnlttpspqnisncryaqtpanmfyivacdnrdqrr
    dppqypvvpvhldrii