PDB entry 1k2a

View 1k2a on RCSB PDB site
Description: Modified Form of Eosinophil-derived Neurotoxin
Deposited on 2001-09-26, released 2002-04-03
The last revision prior to the SCOP 1.63 freeze date was dated 2002-04-03, with a file datestamp of 2002-04-03.
Experiment type: XRAY
Resolution: 1 Å
R-factor: 0.135
AEROSPACI score: 0.97 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.63: d1k2aa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1k2aA (A:)
hvkppqftwaqwfetqhinmtsqqctnamqvinnyqrrcknqntfllttfanvvnvcgnp
nmtcpsnktrknchhsgsqvplihcnlttpspqnisncryaqtpanmfyivacdnrdqrr
dppqypvvpvhldrii