PDB entry 1k26

View 1k26 on RCSB PDB site
Description: Structure of a Nudix Protein from Pyrobaculum aerophilum Solved by the Single Wavelength Anomolous Scattering Method
Class: structural genomics, unknown function
Keywords: nudix/mutt-like fold, mixed alpha/beta, dimer, putative nudix hydrolase, structural genomics
Deposited on 2001-09-26, released 2002-04-03
The last revision prior to the SCOP 1.73 freeze date was dated 2002-04-03, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.183
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nudix homolog
    Species: Pyrobaculum aerophilum
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1k26a_
  • Chain 'B':
    Compound: Nudix homolog
    Species: Pyrobaculum aerophilum
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1k26b_
  • Heterogens: SO4, IR3, NI, GOL, ACY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1k26A (A:)
    mivtsgvlvengkvllvkhkrlgvyiypgghvehnetpieavkrefeeetgivvepigft
    ygiidenaverpmplvileevvkypeethihfdliylvkrvggdlkngewidvreidrie
    tfpnvrkvvslalstlyrlgkisklaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1k26A (A:)
    mivtsgvlvengkvllvkhkrlgvyiypgghvehnetpieavkrefeeetgivvepigft
    ygiidenaverpmplvileevvkypeethihfdliylvkrvggdlkngewidvreidrie
    tfpnvrkvvslalstlyrlgkisklaaale
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1k26B (B:)
    mivtsgvlvengkvllvkhkrlgvyiypgghvehnetpieavkrefeeetgivvepigft
    ygiidenaverpmplvileevvkypeethihfdliylvkrvggdlkngewidvreidrie
    tfpnvrkvvslalstlyrlgkisklaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1k26B (B:)
    mivtsgvlvengkvllvkhkrlgvyiypgghvehnetpieavkrefeeetgivvepigft
    ygiidenaverpmplvileevvkypeethihfdliylvkrvggdlkngewidvreidrie
    tfpnvrkvvslalstlyrlgkisklaa