PDB entry 1k26

View 1k26 on RCSB PDB site
Description: Structure of a Nudix Protein from Pyrobaculum aerophilum Solved by the Single Wavelength Anomolous Scattering Method
Deposited on 2001-09-26, released 2002-04-03
The last revision prior to the SCOP 1.63 freeze date was dated 2002-04-03, with a file datestamp of 2002-04-03.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.183
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.63: d1k26a_
  • Chain 'B':
    Domains in SCOP 1.63: d1k26b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1k26A (A:)
    mivtsgvlvengkvllvkhkrlgvyiypgghvehnetpieavkrefeeetgivvepigft
    ygiidenaverpmplvileevvkypeethihfdliylvkrvggdlkngewidvreidrie
    tfpnvrkvvslalstlyrlgkisklaaale
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1k26B (B:)
    mivtsgvlvengkvllvkhkrlgvyiypgghvehnetpieavkrefeeetgivvepigft
    ygiidenaverpmplvileevvkypeethihfdliylvkrvggdlkngewidvreidrie
    tfpnvrkvvslalstlyrlgkisklaa