PDB entry 1k1z

View 1k1z on RCSB PDB site
Description: Solution structure of N-terminal SH3 domain mutant(P33G) of murine Vav
Class: signaling protein
Keywords: SH3, Proto-oncogene
Deposited on 2001-09-26, released 2001-10-10
The last revision prior to the SCOP 1.75 freeze date was dated 2003-06-24, with a file datestamp of 2007-07-20.
Experiment type: NMRAVE
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: vav
    Species: MUS MUSCULUS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P27870 (0-77)
      • engineered (32)
    Domains in SCOP 1.75: d1k1za_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1k1zA (A:)
    raqdkkrnelglpkmevfqeyygippppgafggflrlnpgdiveltkaeaehnwwegrnt
    atnevgwfpcnrvhpyvh