PDB entry 1k1y

View 1k1y on RCSB PDB site
Description: Crystal structure of thermococcus litoralis 4-alpha-glucanotransferase complexed with acarbose
Class: transferase
Keywords: 4-alpha-glucanotransferase complexed with acarbose, transferase
Deposited on 2001-09-26, released 2003-06-17
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.198
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 4-alpha-glucanotransferase
    Species: Thermococcus litoralis [TaxId:2265]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1k1ya1, d1k1ya2, d1k1ya3
  • Chain 'B':
    Compound: 4-alpha-glucanotransferase
    Species: Thermococcus litoralis [TaxId:2265]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1k1yb1, d1k1yb2, d1k1yb3
  • Heterogens: ACR, MAL, CA, TRS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1k1yA (A:)
    merinfifgihnhqplgnfgwvfeeaynrsyrpfmeileefpemkvnvhfsgpllewiee
    nkpdyldllrslikrgqleivvagfyepvlaaipkedrlvqiemlkdyarklgydakgvw
    ltervwqpelvkslreagieyvvvddyhfmsaglskeelfwpyytedggevitvfpidek
    lrylipfrpvkktieylesltsddpskvavfhddgekfgvwpgtyewvyekgwlreffda
    itsnekinlmtyseylskftprglvylpiasyfemsewslpakqaklfvefveqlkeegk
    fekyrvfvrggiwknfffkypesnfmhkrmlmvskavrdnpearkyilkaqcndaywhgv
    fggiylphlrrtvweniikaqrylkpenkildvdfdgraeimvendgfiatikphyggsi
    felsskrkavnyndvlprrwehyhevpeatkpekeseegiasihelgkqipeeirrelay
    dwqlrailqdhfikpeetldnyrlvkyhelgdfvnqpyeyemiengvklwreggvyaeek
    iparvekkieltedgfiakyrvllekpykalfgveinlavhsvmekpeefeakefevndp
    ygigkvrieldkaakvwkfpiktlsqseagwdfiqqgvsytmlfpiekeleftvrfrel
    

    Sequence, based on observed residues (ATOM records): (download)
    >1k1yA (A:)
    merinfifgihnhqplgnfgwvfeeaynrsyrpfmeileefpemkvnvhfsgpllewiee
    nkpdyldllrslikrgqleivvagfyepvlaaipkedrlvqiemlkdyarklgydakgvw
    ltervwqpelvkslreagieyvvvddyhfmsaglskeelfwpyytedggevitvfpidek
    lrylipfrpvkktieylesltsddpskvavfhddgekfgvwpgtyewvyekgwlreffda
    itsnekinlmtyseylskftprglvylpiasyfemsewslpakqaklfvefveqlkeegk
    fekyrvfvrggiwknfffkypesnfmhkrmlmvskavrdnpearkyilkaqcndaywhgv
    fggiylphlrrtvweniikaqrylkpenkildvdfdgraeimvendgfiatikphyggsi
    felsskrkavnyndvlprrwehyheqipeeirrelaydwqlrailqdhfikpeetldnyr
    lvkyhelgdfvnqpyeyemiengvklwreggvyaeekiparvekkieltedgfiakyrvl
    lekpykalfgveinlavhsvmekpeefeakefevndpygigkvrieldkaakvwkfpikt
    lsqseagwdfiqqgvsytmlfpiekeleftvrfrel
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1k1yB (B:)
    merinfifgihnhqplgnfgwvfeeaynrsyrpfmeileefpemkvnvhfsgpllewiee
    nkpdyldllrslikrgqleivvagfyepvlaaipkedrlvqiemlkdyarklgydakgvw
    ltervwqpelvkslreagieyvvvddyhfmsaglskeelfwpyytedggevitvfpidek
    lrylipfrpvkktieylesltsddpskvavfhddgekfgvwpgtyewvyekgwlreffda
    itsnekinlmtyseylskftprglvylpiasyfemsewslpakqaklfvefveqlkeegk
    fekyrvfvrggiwknfffkypesnfmhkrmlmvskavrdnpearkyilkaqcndaywhgv
    fggiylphlrrtvweniikaqrylkpenkildvdfdgraeimvendgfiatikphyggsi
    felsskrkavnyndvlprrwehyhevpeatkpekeseegiasihelgkqipeeirrelay
    dwqlrailqdhfikpeetldnyrlvkyhelgdfvnqpyeyemiengvklwreggvyaeek
    iparvekkieltedgfiakyrvllekpykalfgveinlavhsvmekpeefeakefevndp
    ygigkvrieldkaakvwkfpiktlsqseagwdfiqqgvsytmlfpiekeleftvrfrel
    

    Sequence, based on observed residues (ATOM records): (download)
    >1k1yB (B:)
    erinfifgihnhqplgnfgwvfeeaynrsyrpfmeileefpemkvnvhfsgpllewieen
    kpdyldllrslikrgqleivvagfyepvlaaipkedrlvqiemlkdyarklgydakgvwl
    tervwqpelvkslreagieyvvvddyhfmsaglskeelfwpyytedggevitvfpidekl
    rylipfrpvkktieylesltsddpskvavfhddgekfgvwpgtyewvyekgwlreffdai
    tsnekinlmtyseylskftprglvylpiasyfemsewslpakqaklfvefveqlkeegkf
    ekyrvfvrggiwknfffkypesnfmhkrmlmvskavrdnpearkyilkaqcndaywhgvf
    ggiylphlrrtvweniikaqrylkpenkildvdfdgraeimvendgfiatikphyggsif
    elsskrkavnyndvlprrwehyhevqipeeirrelaydwqlrailqdhfikpeetldnyr
    lvkyhelgdfvnqpyeyemiengvklwreggvyaeekiparvekkieltedgfiakyrvl
    lekpykalfgveinlavhsvmekpeefeakefevndpygigkvrieldkaakvwkfpikt
    lsqseagwdfiqqgvsytmlfpiekeleftvrfrel