PDB entry 1k1x

View 1k1x on RCSB PDB site
Description: Crystal structure of 4-alpha-glucanotransferase from thermococcus litoralis
Deposited on 2001-09-26, released 2003-06-17
The last revision prior to the SCOP 1.71 freeze date was dated 2003-06-17, with a file datestamp of 2003-06-17.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.195
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1k1xA (A:)
    merinfifgihnhqplgnfgwvfeeaynrsyrpfmeileefpemkvnvhfsgpllewiee
    nkpdyldllrslikrgqleivvagfyepvlaaipkedrlvqiemlkdyarklgydakgvw
    ltervwqpelvkslreagieyvvvddyhfmsaglskeelfwpyytedggevitvfpidek
    lrylipfrpvkktieylesltsddpskvavfhddgekfgvwpgtyewvyekgwlreffda
    itsnekinlmtyseylskftprglvylpiasyfemsewslpakqaklfvefveqlkeegk
    fekyrvfvrggiwknfffkypesnfmhkrmlmvskavrdnpearkyilkaqcndaywhgv
    fggiylphlrrtvweniikaqrylkpenkildvdfdgraeimvendgfiatikphyggsi
    felsskrkavnyndvlprrwehyhevpeatkpekeseegiasihelgkqipeeirrelay
    dwqlrailqdhfikpeetldnyrlvkyhelgdfvnqpyeyemiengvklwreggvyaeek
    iparvekkieltedgfiakyrvllekpykalfgveinlavhsvmekpeefeakefevndp
    ygigkvrieldkaakvwkfpiktlsqseagwdfiqqgvsytmlfpiekeleftvrfrel
    

    Sequence, based on observed residues (ATOM records): (download)
    >1k1xA (A:)
    merinfifgihnhqplgnfgwvfeeaynrsyrpfmeileefpemkvnvhfsgpllewiee
    nkpdyldllrslikrgqleivvagfyepvlaaipkedrlvqiemlkdyarklgydakgvw
    ltervwqpelvkslreagieyvvvddyhfmsaglskeelfwpyytedggevitvfpidek
    lrylipfrpvkktieylesltsddpskvavfhddgekfgvwpgtyewvyekgwlreffda
    itsnekinlmtyseylskftprglvylpiasyfemsewslpakqaklfvefveqlkeegk
    fekyrvfvrggiwknfffkypesnfmhkrmlmvskavrdnpearkyilkaqcndaywhgv
    fggiylphlrrtvweniikaqrylkpenkildvdfdgraeimvendgfiatikphyggsi
    felsskrkavnyndvlprrwehyheqipeeirrelaydwqlrailqdhfikpeetldnyr
    lvkyhelgdfvnqpyeyemiengvklwreggvyaeekiparvekkieltedgfiakyrvl
    lekpykalfgveinlavhsvmekpeefeakefevndpygigkvrieldkaakvwkfpikt
    lsqseagwdfiqqgvsytmlfpiekeleftvrfrel
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1k1xB (B:)
    merinfifgihnhqplgnfgwvfeeaynrsyrpfmeileefpemkvnvhfsgpllewiee
    nkpdyldllrslikrgqleivvagfyepvlaaipkedrlvqiemlkdyarklgydakgvw
    ltervwqpelvkslreagieyvvvddyhfmsaglskeelfwpyytedggevitvfpidek
    lrylipfrpvkktieylesltsddpskvavfhddgekfgvwpgtyewvyekgwlreffda
    itsnekinlmtyseylskftprglvylpiasyfemsewslpakqaklfvefveqlkeegk
    fekyrvfvrggiwknfffkypesnfmhkrmlmvskavrdnpearkyilkaqcndaywhgv
    fggiylphlrrtvweniikaqrylkpenkildvdfdgraeimvendgfiatikphyggsi
    felsskrkavnyndvlprrwehyhevpeatkpekeseegiasihelgkqipeeirrelay
    dwqlrailqdhfikpeetldnyrlvkyhelgdfvnqpyeyemiengvklwreggvyaeek
    iparvekkieltedgfiakyrvllekpykalfgveinlavhsvmekpeefeakefevndp
    ygigkvrieldkaakvwkfpiktlsqseagwdfiqqgvsytmlfpiekeleftvrfrel
    

    Sequence, based on observed residues (ATOM records): (download)
    >1k1xB (B:)
    erinfifgihnhqplgnfgwvfeeaynrsyrpfmeileefpemkvnvhfsgpllewieen
    kpdyldllrslikrgqleivvagfyepvlaaipkedrlvqiemlkdyarklgydakgvwl
    tervwqpelvkslreagieyvvvddyhfmsaglskeelfwpyytedggevitvfpidekl
    rylipfrpvkktieylesltsddpskvavfhddgekfgvwpgtyewvyekgwlreffdai
    tsnekinlmtyseylskftprglvylpiasyfemsewslpakqaklfvefveqlkeegkf
    ekyrvfvrggiwknfffkypesnfmhkrmlmvskavrdnpearkyilkaqcndaywhgvf
    ggiylphlrrtvweniikaqrylkpenkildvdfdgraeimvendgfiatikphyggsif
    elsskrkavnyndvlprrwehyhevqipeeirrelaydwqlrailqdhfikpeetldnyr
    lvkyhelgdfvnqpyeyemiengvklwreggvyaeekiparvekkieltedgfiakyrvl
    lekpykalfgveinlavhsvmekpeefeakefevndpygigkvrieldkaakvwkfpikt
    lsqseagwdfiqqgvsytmlfpiekeleftvrfrel