PDB entry 1k1w

View 1k1w on RCSB PDB site
Description: Crystal structure of 4-alpha-glucanotransferase from thermococcus litoralis
Class: transferase
Keywords: 4-alpha-glucanotransferase, seleno-methionine
Deposited on 2001-09-26, released 2003-06-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.221
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 4-alpha-glucanotransferase
    Species: Thermococcus litoralis [TaxId:2265]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O32462 (Start-658)
      • modified residue (34)
      • modified residue (43)
      • modified residue (103)
      • modified residue (149)
      • modified residue (249)
      • modified residue (274)
      • modified residue (325)
      • modified residue (329)
      • modified residue (331)
      • modified residue (401)
      • modified residue (521)
      • modified residue (583)
      • modified residue (641)
    Domains in SCOPe 2.07: d1k1wa1, d1k1wa2, d1k1wa3
  • Heterogens: GLC, CA, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1k1wA (A:)
    merinfifgihnhqplgnfgwvfeeaynrsyrpfmeileefpemkvnvhfsgpllewiee
    nkpdyldllrslikrgqleivvagfyepvlaaipkedrlvqiemlkdyarklgydakgvw
    ltervwqpelvkslreagieyvvvddyhfmsaglskeelfwpyytedggevitvfpidek
    lrylipfrpvkktieylesltsddpskvavfhddgekfgvwpgtyewvyekgwlreffda
    itsnekinlmtyseylskftprglvylpiasyfemsewslpakqaklfvefveqlkeegk
    fekyrvfvrggiwknfffkypesnfmhkrmlmvskavrdnpearkyilkaqcndaywhgv
    fggiylphlrrtvweniikaqrylkpenkildvdfdgraeimvendgfiatikphyggsi
    felsskrkavnyndvlprrwehyhevpeatkpekeseegiasihelgkqipeeirrelay
    dwqlrailqdhfikpeetldnyrlvkyhelgdfvnqpyeyemiengvklwreggvyaeek
    iparvekkieltedgfiakyrvllekpykalfgveinlavhsvmekpeefeakefevndp
    ygigkvrieldkaakvwkfpiktlsqseagwdfiqqgvsytmlfpiekeleftvrfrel
    

    Sequence, based on observed residues (ATOM records): (download)
    >1k1wA (A:)
    infifgihnhqplgnfgwvfeeaynrsyrpfmeileefpemkvnvhfsgpllewieenkp
    dyldllrslikrgqleivvagfyepvlaaipkedrlvqiemlkdyarklgydakgvwlte
    rvwqpelvkslreagieyvvvddyhfmsaglskeelfwpyytedggevitvfpideklry
    lipfrpvkktieyleslskvavfhddgekfgvwpgtywlreffdaitekinlmtyseyls
    kftprglvylpiasyfemsewslpakqaklfvefveqlkeegkfekyrvfvrggiwknff
    fkypesnfmhkrmlmvskavrdnpearkyilkaqcndaywhgvfggiylphlrrtvweni
    ikaqrylkpenkildvdfdgraeimvendgfiatikphyggsifelsskrkavnyndvlp
    rrwehyhevpeahelgkqipeeirrelaydwqlrailqdhfikpeetldnyrlvkyhelg
    dfvnqpyeyemiengvklwreggvyaeekiparvekkieltedgfiakyrvllekpykal
    fgveinlavhsvmekpeefeakefevndpygigkvrieldkaakvwkfpiktlsqseagw
    dfiqqgvsytmlfpiekeleftvrfrel