PDB entry 1k1q

View 1k1q on RCSB PDB site
Description: Crystal Structure of a DinB Family Error Prone DNA Polymerase from Sulfolobus solfataricus
Class: transcription
Keywords: DNA polymerase, error-prone polymerase, lesion-bypass polymerase, TRANSCRIPTION
Deposited on 2001-09-25, released 2001-10-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.263
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DBH protein
    Species: Sulfolobus solfataricus [TaxId:2287]
    Gene: DBH
    Database cross-references and differences (RAF-indexed):
    • Uniprot P96022 (0-End)
      • engineered (30)
    Domains in SCOPe 2.07: d1k1qa1, d1k1qa2
  • Chain 'B':
    Compound: DBH protein
    Species: Sulfolobus solfataricus [TaxId:2287]
    Gene: DBH
    Database cross-references and differences (RAF-indexed):
    • Uniprot P96022 (0-End)
      • engineered (30)
    Domains in SCOPe 2.07: d1k1qb1, d1k1qb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1k1qA (A:)
    mivifvdfdyffaqveevlnpqykgkplvvsvysgrtktsgavatanyearklgvkagmp
    iikamqiapsaiyvpmrkpiyeafsnrimnllnkhadkievasideayldvtnkvegnfe
    ngielarkikqeilekekitvtvgvapnkilakiiadkskpnglgvirptevqdflneld
    ideipgigsvlarrlnelgiqklrdilsknynelekitgkakalyllklaqnkysepven
    kskiphgryltlpyntrdvkvilpylkkaineaynkvngipmritviaimedldilskgk
    kfkhgisidnaykvaedllrellvrdkrrnvrrigvkldniiinktnlsdffdi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1k1qA (A:)
    mivifvdfdyffaqveevlnpqykgkplvvsvysanyearklgvkagmpiikamqiapsa
    iyvpmrkpiyeafsnrimnllnkhadkievasideayldvtnkvegnfengielarkikq
    eilekekitvtvgvapnkilakiiadkskpnglgvirptevqdflneldideipgigsvl
    arrlnelgiqklrdilsknynelekitgkakalyllklaqnkysepvenkskiphgrylt
    lpyntrdvkvilpylkkaineaynkvngipmritviaimedldilskgkkfkhgisidna
    ykvaedllrellvrdkrrnvrrigvkldniiin
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1k1qB (B:)
    mivifvdfdyffaqveevlnpqykgkplvvsvysgrtktsgavatanyearklgvkagmp
    iikamqiapsaiyvpmrkpiyeafsnrimnllnkhadkievasideayldvtnkvegnfe
    ngielarkikqeilekekitvtvgvapnkilakiiadkskpnglgvirptevqdflneld
    ideipgigsvlarrlnelgiqklrdilsknynelekitgkakalyllklaqnkysepven
    kskiphgryltlpyntrdvkvilpylkkaineaynkvngipmritviaimedldilskgk
    kfkhgisidnaykvaedllrellvrdkrrnvrrigvkldniiinktnlsdffdi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1k1qB (B:)
    mivifvdfdyffaqveevlnpqykgkplvvsvysgtsgavatanyearklgvkagmpiik
    amqiapsaiyvpmrkpiyeafsnrimnllnkhadkievasideayldvtnkvegnfengi
    elarkikqeilekekitvtvgvapnkilakiiadkskpnglgvirptevqdflneldide
    ipgigsvlarrlnelgiqklrdilsknynelekitgkakalyllklaqnkysepvenksk
    iphgryltlpyntrdvkvilpylkkaineaynkvngipmritviaimedldilskgkkfk
    hgisidnaykvaedllrellvrdkrrnvrrigvkldniiin