PDB entry 1k1c

View 1k1c on RCSB PDB site
Description: Solution Structure of Crh, the Bacillus subtilis Catabolite Repression HPr
Class: transport protein
Keywords: open-faced b-sandwich, phosphotransferase system, carbon catabolite repression
Deposited on 2001-09-25, released 2001-10-17
The last revision prior to the SCOP 1.73 freeze date was dated 2002-04-03, with a file datestamp of 2007-06-04.
Experiment type: NMR24
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: catabolite repression HPr-like protein
  Species: Bacillus subtilis
  Database cross-references and differences (RAF-indexed):
  • Uniprot O06976 (0-83)
  Domains in SCOP 1.73: d1k1ca_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1k1cA (A:)
  vqqkvevrlktglqarpaalfvqeanrftsdvflekdgkkvnaksimglmslavstgtev
  tliaqgedeqealeklaayvqeev