PDB entry 1k1a

View 1k1a on RCSB PDB site
Description: Crystal structure of the ankyrin repeat domain of Bcl-3: a unique member of the IkappaB protein family
Class: transcription
Keywords: Bcl-3, NF-kappaB transcription factors, IkappaB proteins
Deposited on 2001-09-24, released 2001-11-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.86 Å
R-factor: 0.2
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: B-cell lymphoma 3-encoded protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1k1aa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1k1aA (A:)
    matradedgdtplhiavvqgnlpavhrlvnlfqqggreldiynnlrqtplhlavittlps
    vvrllvtagaspmaldrhgqtaahlacehrsptclralldsaapgtldlearnydgltal
    hvavntecqetvqlllergadidavdiksgrsplihavennslsmvqlllqhganvnaqm
    ysgssalhsasgrgllplvrtlvrsgadsslknchndtplmvarsrrvidilrgkatrpa
    s
    

    Sequence, based on observed residues (ATOM records): (download)
    >1k1aA (A:)
    edgdtplhiavvqgnlpavhrlvnlfqqggreldiynnlrqtplhlavittlpsvvrllv
    tagaspmaldrhgqtaahlacehrsptclralldsaapgtldlearnydgltalhvavnt
    ecqetvqlllergadidavdiksgrsplihavennslsmvqlllqhganvnaqmysgssa
    lhsasgrgllplvrtlvrsgadsslknchndtplmvarsrrvidilrg