PDB entry 1k19

View 1k19 on RCSB PDB site
Description: NMR Solution Structure of the Chemosensory Protein CSP2 from Moth Mamestra brassicae
Class: lipid transport
Keywords: NMR, Chemosensory, Pheromone, LIPID TRANSPORT
Deposited on 2001-09-24, released 2002-12-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Chemosensory Protein CSP2
    Species: Mamestra brassicae [TaxId:55057]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1k19a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1k19A (A:)
    edkytdkydninldeilankrllvayvncvmergkcspegkelkehlqdaiengckkcte
    nqekgayrviehlikneieiwreltakydptgnwrkkyedrakaagivipee