PDB entry 1k0z

View 1k0z on RCSB PDB site
Description: Crystal Structure of the PvuII endonuclease with Pr3+ and SO4 ions bound in the active site at 2.05A.
Class: hydrolase
Keywords: PvuII, endonuclease, restriction enzyme, catalysis, ions, xrays, lanthanades, HYDROLASE
Deposited on 2001-09-21, released 2003-06-17
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.19
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: type II restriction enzyme pvuii
    Species: Proteus vulgaris [TaxId:585]
    Gene: PvuiiR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1k0za_
  • Chain 'B':
    Compound: type II restriction enzyme pvuii
    Species: Proteus vulgaris [TaxId:585]
    Gene: PvuiiR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1k0zb_
  • Heterogens: PR, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1k0zA (A:)
    shpdlnkllelwphiqeyqdlalkhgindifqdnggkllqvllitgltvlpgregndavd
    nagqeyelksinidltkgfsthhhmnpviiakyrqvpwifaiyrgiaieaiyrlepkdle
    fyydkwerkwysdghkdinnpkipvkyvmehgtkiy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1k0zA (A:)
    dlnkllelwphiqeyqdlalkhgindifqdnggkllqvllitgltvlpggndavdnagqe
    yelksinidltkgfsthhhmnpviiakyrqvpwifaiyrgiaieaiyrlepkdlefyydk
    werkwysdghkdinnpkipvkyvmehgtkiy
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1k0zB (B:)
    shpdlnkllelwphiqeyqdlalkhgindifqdnggkllqvllitgltvlpgregndavd
    nagqeyelksinidltkgfsthhhmnpviiakyrqvpwifaiyrgiaieaiyrlepkdle
    fyydkwerkwysdghkdinnpkipvkyvmehgtkiy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1k0zB (B:)
    shpdlnkllelwphiqeyqdlalkhgindifqdnggkllqvllitgltvlpggndavdna
    gqeyelksinidltkgfsthhhmnpviiakyrqvpwifaiyrgiaieaiyrlepkdlefy
    ydkwerkwysdghkdinnpkipvkyvmehgtkiy