PDB entry 1k0x

View 1k0x on RCSB PDB site
Description: Solution Structure of Melanoma Inhibitory Activity Protein
Class: hormone/growth factor
Keywords: SH3 subdomain, HORMONE/GROWTH FACTOR COMPLEX
Deposited on 2001-09-21, released 2002-07-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: melanoma derived growth regulatory protein
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q16674 (1-107)
      • see remark 999 (0)
    Domains in SCOPe 2.07: d1k0xa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1k0xA (A:)
    mgpmpkladrklcadqecshpismavalqdymapdcrfltihrgqvvyvfsklkgrgrlf
    wggsvqgdyygdlaarlgyfpssivredqtlkpgkvdvktdkwdfycq