PDB entry 1k0v

View 1k0v on RCSB PDB site
Description: Copper trafficking: the solution structure of Bacillus subtilis CopZ
Class: metal transport
Keywords: beta-alpha-beta-beta-alpha-beta, METAL TRANSPORT
Deposited on 2001-09-21, released 2001-12-19
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: CopZ
    Species: Bacillus subtilis [TaxId:1423]
    Gene: bscopz
    Database cross-references and differences (RAF-indexed):
    • Uniprot O32221 (0-68)
      • see remark 999 (69-72)
    Domains in SCOPe 2.06: d1k0va1, d1k0va2
  • Heterogens: CU1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1k0vA (A:)
meqktlqvegmscqhcvkavetsvgeldgvsavhvnleagkvdvsfdadkvsvkdiadai
edqgydvakiegr