PDB entry 1k0u

View 1k0u on RCSB PDB site
Description: Inhibition of S-adenosylhomocysteine Hydrolase by "acyclic sugar" Adenosine Analogue D-eritadenine
Class: hydrolase
Keywords: S-adenosylhomocysteine, hydrolase, D-eritadenine, inhibitor
Deposited on 2001-09-20, released 2001-10-17
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.183
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: s-adenosyl-l-homocysteine hydrolase
    Species: Rattus norvegicus [TaxId:10116]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1k0ua1, d1k0ua2
  • Chain 'B':
    Compound: s-adenosyl-l-homocysteine hydrolase
    Species: Rattus norvegicus [TaxId:10116]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1k0ub1, d1k0ub2
  • Chain 'C':
    Compound: s-adenosyl-l-homocysteine hydrolase
    Species: Rattus norvegicus [TaxId:10116]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1k0uc1, d1k0uc2
  • Chain 'D':
    Compound: s-adenosyl-l-homocysteine hydrolase
    Species: Rattus norvegicus [TaxId:10116]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1k0ud1, d1k0ud2
  • Chain 'E':
    Compound: s-adenosyl-l-homocysteine hydrolase
    Species: Rattus norvegicus [TaxId:10116]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1k0ue1, d1k0ue2
  • Chain 'F':
    Compound: s-adenosyl-l-homocysteine hydrolase
    Species: Rattus norvegicus [TaxId:10116]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1k0uf1, d1k0uf2
  • Chain 'G':
    Compound: s-adenosyl-l-homocysteine hydrolase
    Species: Rattus norvegicus [TaxId:10116]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1k0ug1, d1k0ug2
  • Chain 'H':
    Compound: s-adenosyl-l-homocysteine hydrolase
    Species: Rattus norvegicus [TaxId:10116]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1k0uh1, d1k0uh2
  • Heterogens: NAD, DEA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1k0uA (A:)
    adklpykvadiglaawgrkaldiaenempglmrmremysaskplkgariagclhmtveta
    vlietlvalgaevrwsscnifstqdhaaaaiakagipvfawkgetdeeylwcieqtlhfk
    dgplnmilddggdltnlihtkhpqllsgirgiseetttgvhnlykmmangilkvpainvn
    dsvtkskfdnlygcreslidgikratdvmiagkvavvagygdvgkgcaqalrgfgarvii
    teidpinalqaamegyevttmdeackegnifvtttgcvdiilgrhfeqmkddaivcnigh
    fdveidvkwlnenavekvnikpqvdryllknghriillaegrlvnlgcamghpsfvmsns
    ftnqvmaqielwthpdkypvgvhflpkkldeavaeahlgklnvkltkltekqaqylgmpi
    ngpfkpdhyry
    

    Sequence, based on observed residues (ATOM records): (download)
    >1k0uA (A:)
    dklpykvadiglaawgrkaldiaenempglmrmremysaskplkgariagclhmtvetav
    lietlvalgaevrwsscnifstqdhaaaaiakagipvfawkgetdeeylwcieqtlhfkd
    gplnmilddggdltnlihtkhpqllsgirgiseetttgvhnlykmmangilkvpainvnd
    svtkskfdnlygcreslidgikratdvmiagkvavvagygdvgkgcaqalrgfgarviit
    eidpinalqaamegyevttmdeackegnifvtttgcvdiilgrhfeqmkddaivcnighf
    dveidvkwlnenavekvnikpqvdryllknghriillaegrlvnlgcamghpsfvmsnsf
    tnqvmaqielwthpdkypvgvhflpkkldeavaeahlgklnvkltkltekqaqylgmpin
    gpfkpdhyry
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1k0uB (B:)
    adklpykvadiglaawgrkaldiaenempglmrmremysaskplkgariagclhmtveta
    vlietlvalgaevrwsscnifstqdhaaaaiakagipvfawkgetdeeylwcieqtlhfk
    dgplnmilddggdltnlihtkhpqllsgirgiseetttgvhnlykmmangilkvpainvn
    dsvtkskfdnlygcreslidgikratdvmiagkvavvagygdvgkgcaqalrgfgarvii
    teidpinalqaamegyevttmdeackegnifvtttgcvdiilgrhfeqmkddaivcnigh
    fdveidvkwlnenavekvnikpqvdryllknghriillaegrlvnlgcamghpsfvmsns
    ftnqvmaqielwthpdkypvgvhflpkkldeavaeahlgklnvkltkltekqaqylgmpi
    ngpfkpdhyry
    

    Sequence, based on observed residues (ATOM records): (download)
    >1k0uB (B:)
    dklpykvadiglaawgrkaldiaenempglmrmremysaskplkgariagclhmtvetav
    lietlvalgaevrwsscnifstqdhaaaaiakagipvfawkgetdeeylwcieqtlhfkd
    gplnmilddggdltnlihtkhpqllsgirgiseetttgvhnlykmmangilkvpainvnd
    svtkskfdnlygcreslidgikratdvmiagkvavvagygdvgkgcaqalrgfgarviit
    eidpinalqaamegyevttmdeackegnifvtttgcvdiilgrhfeqmkddaivcnighf
    dveidvkwlnenavekvnikpqvdryllknghriillaegrlvnlgcamghpsfvmsnsf
    tnqvmaqielwthpdkypvgvhflpkkldeavaeahlgklnvkltkltekqaqylgmpin
    gpfkpdhyry
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1k0uC (C:)
    adklpykvadiglaawgrkaldiaenempglmrmremysaskplkgariagclhmtveta
    vlietlvalgaevrwsscnifstqdhaaaaiakagipvfawkgetdeeylwcieqtlhfk
    dgplnmilddggdltnlihtkhpqllsgirgiseetttgvhnlykmmangilkvpainvn
    dsvtkskfdnlygcreslidgikratdvmiagkvavvagygdvgkgcaqalrgfgarvii
    teidpinalqaamegyevttmdeackegnifvtttgcvdiilgrhfeqmkddaivcnigh
    fdveidvkwlnenavekvnikpqvdryllknghriillaegrlvnlgcamghpsfvmsns
    ftnqvmaqielwthpdkypvgvhflpkkldeavaeahlgklnvkltkltekqaqylgmpi
    ngpfkpdhyry
    

    Sequence, based on observed residues (ATOM records): (download)
    >1k0uC (C:)
    dklpykvadiglaawgrkaldiaenempglmrmremysaskplkgariagclhmtvetav
    lietlvalgaevrwsscnifstqdhaaaaiakagipvfawkgetdeeylwcieqtlhfkd
    gplnmilddggdltnlihtkhpqllsgirgiseetttgvhnlykmmangilkvpainvnd
    svtkskfdnlygcreslidgikratdvmiagkvavvagygdvgkgcaqalrgfgarviit
    eidpinalqaamegyevttmdeackegnifvtttgcvdiilgrhfeqmkddaivcnighf
    dveidvkwlnenavekvnikpqvdryllknghriillaegrlvnlgcamghpsfvmsnsf
    tnqvmaqielwthpdkypvgvhflpkkldeavaeahlgklnvkltkltekqaqylgmpin
    gpfkpdhyry
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1k0uD (D:)
    adklpykvadiglaawgrkaldiaenempglmrmremysaskplkgariagclhmtveta
    vlietlvalgaevrwsscnifstqdhaaaaiakagipvfawkgetdeeylwcieqtlhfk
    dgplnmilddggdltnlihtkhpqllsgirgiseetttgvhnlykmmangilkvpainvn
    dsvtkskfdnlygcreslidgikratdvmiagkvavvagygdvgkgcaqalrgfgarvii
    teidpinalqaamegyevttmdeackegnifvtttgcvdiilgrhfeqmkddaivcnigh
    fdveidvkwlnenavekvnikpqvdryllknghriillaegrlvnlgcamghpsfvmsns
    ftnqvmaqielwthpdkypvgvhflpkkldeavaeahlgklnvkltkltekqaqylgmpi
    ngpfkpdhyry
    

    Sequence, based on observed residues (ATOM records): (download)
    >1k0uD (D:)
    dklpykvadiglaawgrkaldiaenempglmrmremysaskplkgariagclhmtvetav
    lietlvalgaevrwsscnifstqdhaaaaiakagipvfawkgetdeeylwcieqtlhfkd
    gplnmilddggdltnlihtkhpqllsgirgiseetttgvhnlykmmangilkvpainvnd
    svtkskfdnlygcreslidgikratdvmiagkvavvagygdvgkgcaqalrgfgarviit
    eidpinalqaamegyevttmdeackegnifvtttgcvdiilgrhfeqmkddaivcnighf
    dveidvkwlnenavekvnikpqvdryllknghriillaegrlvnlgcamghpsfvmsnsf
    tnqvmaqielwthpdkypvgvhflpkkldeavaeahlgklnvkltkltekqaqylgmpin
    gpfkpdhyry
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1k0uE (E:)
    adklpykvadiglaawgrkaldiaenempglmrmremysaskplkgariagclhmtveta
    vlietlvalgaevrwsscnifstqdhaaaaiakagipvfawkgetdeeylwcieqtlhfk
    dgplnmilddggdltnlihtkhpqllsgirgiseetttgvhnlykmmangilkvpainvn
    dsvtkskfdnlygcreslidgikratdvmiagkvavvagygdvgkgcaqalrgfgarvii
    teidpinalqaamegyevttmdeackegnifvtttgcvdiilgrhfeqmkddaivcnigh
    fdveidvkwlnenavekvnikpqvdryllknghriillaegrlvnlgcamghpsfvmsns
    ftnqvmaqielwthpdkypvgvhflpkkldeavaeahlgklnvkltkltekqaqylgmpi
    ngpfkpdhyry
    

    Sequence, based on observed residues (ATOM records): (download)
    >1k0uE (E:)
    dklpykvadiglaawgrkaldiaenempglmrmremysaskplkgariagclhmtvetav
    lietlvalgaevrwsscnifstqdhaaaaiakagipvfawkgetdeeylwcieqtlhfkd
    gplnmilddggdltnlihtkhpqllsgirgiseetttgvhnlykmmangilkvpainvnd
    svtkskfdnlygcreslidgikratdvmiagkvavvagygdvgkgcaqalrgfgarviit
    eidpinalqaamegyevttmdeackegnifvtttgcvdiilgrhfeqmkddaivcnighf
    dveidvkwlnenavekvnikpqvdryllknghriillaegrlvnlgcamghpsfvmsnsf
    tnqvmaqielwthpdkypvgvhflpkkldeavaeahlgklnvkltkltekqaqylgmpin
    gpfkpdhyry
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1k0uF (F:)
    adklpykvadiglaawgrkaldiaenempglmrmremysaskplkgariagclhmtveta
    vlietlvalgaevrwsscnifstqdhaaaaiakagipvfawkgetdeeylwcieqtlhfk
    dgplnmilddggdltnlihtkhpqllsgirgiseetttgvhnlykmmangilkvpainvn
    dsvtkskfdnlygcreslidgikratdvmiagkvavvagygdvgkgcaqalrgfgarvii
    teidpinalqaamegyevttmdeackegnifvtttgcvdiilgrhfeqmkddaivcnigh
    fdveidvkwlnenavekvnikpqvdryllknghriillaegrlvnlgcamghpsfvmsns
    ftnqvmaqielwthpdkypvgvhflpkkldeavaeahlgklnvkltkltekqaqylgmpi
    ngpfkpdhyry
    

    Sequence, based on observed residues (ATOM records): (download)
    >1k0uF (F:)
    dklpykvadiglaawgrkaldiaenempglmrmremysaskplkgariagclhmtvetav
    lietlvalgaevrwsscnifstqdhaaaaiakagipvfawkgetdeeylwcieqtlhfkd
    gplnmilddggdltnlihtkhpqllsgirgiseetttgvhnlykmmangilkvpainvnd
    svtkskfdnlygcreslidgikratdvmiagkvavvagygdvgkgcaqalrgfgarviit
    eidpinalqaamegyevttmdeackegnifvtttgcvdiilgrhfeqmkddaivcnighf
    dveidvkwlnenavekvnikpqvdryllknghriillaegrlvnlgcamghpsfvmsnsf
    tnqvmaqielwthpdkypvgvhflpkkldeavaeahlgklnvkltkltekqaqylgmpin
    gpfkpdhyry
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1k0uG (G:)
    adklpykvadiglaawgrkaldiaenempglmrmremysaskplkgariagclhmtveta
    vlietlvalgaevrwsscnifstqdhaaaaiakagipvfawkgetdeeylwcieqtlhfk
    dgplnmilddggdltnlihtkhpqllsgirgiseetttgvhnlykmmangilkvpainvn
    dsvtkskfdnlygcreslidgikratdvmiagkvavvagygdvgkgcaqalrgfgarvii
    teidpinalqaamegyevttmdeackegnifvtttgcvdiilgrhfeqmkddaivcnigh
    fdveidvkwlnenavekvnikpqvdryllknghriillaegrlvnlgcamghpsfvmsns
    ftnqvmaqielwthpdkypvgvhflpkkldeavaeahlgklnvkltkltekqaqylgmpi
    ngpfkpdhyry
    

    Sequence, based on observed residues (ATOM records): (download)
    >1k0uG (G:)
    dklpykvadiglaawgrkaldiaenempglmrmremysaskplkgariagclhmtvetav
    lietlvalgaevrwsscnifstqdhaaaaiakagipvfawkgetdeeylwcieqtlhfkd
    gplnmilddggdltnlihtkhpqllsgirgiseetttgvhnlykmmangilkvpainvnd
    svtkskfdnlygcreslidgikratdvmiagkvavvagygdvgkgcaqalrgfgarviit
    eidpinalqaamegyevttmdeackegnifvtttgcvdiilgrhfeqmkddaivcnighf
    dveidvkwlnenavekvnikpqvdryllknghriillaegrlvnlgcamghpsfvmsnsf
    tnqvmaqielwthpdkypvgvhflpkkldeavaeahlgklnvkltkltekqaqylgmpin
    gpfkpdhyry
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1k0uH (H:)
    adklpykvadiglaawgrkaldiaenempglmrmremysaskplkgariagclhmtveta
    vlietlvalgaevrwsscnifstqdhaaaaiakagipvfawkgetdeeylwcieqtlhfk
    dgplnmilddggdltnlihtkhpqllsgirgiseetttgvhnlykmmangilkvpainvn
    dsvtkskfdnlygcreslidgikratdvmiagkvavvagygdvgkgcaqalrgfgarvii
    teidpinalqaamegyevttmdeackegnifvtttgcvdiilgrhfeqmkddaivcnigh
    fdveidvkwlnenavekvnikpqvdryllknghriillaegrlvnlgcamghpsfvmsns
    ftnqvmaqielwthpdkypvgvhflpkkldeavaeahlgklnvkltkltekqaqylgmpi
    ngpfkpdhyry
    

    Sequence, based on observed residues (ATOM records): (download)
    >1k0uH (H:)
    dklpykvadiglaawgrkaldiaenempglmrmremysaskplkgariagclhmtvetav
    lietlvalgaevrwsscnifstqdhaaaaiakagipvfawkgetdeeylwcieqtlhfkd
    gplnmilddggdltnlihtkhpqllsgirgiseetttgvhnlykmmangilkvpainvnd
    svtkskfdnlygcreslidgikratdvmiagkvavvagygdvgkgcaqalrgfgarviit
    eidpinalqaamegyevttmdeackegnifvtttgcvdiilgrhfeqmkddaivcnighf
    dveidvkwlnenavekvnikpqvdryllknghriillaegrlvnlgcamghpsfvmsnsf
    tnqvmaqielwthpdkypvgvhflpkkldeavaeahlgklnvkltkltekqaqylgmpin
    gpfkpdhyry