PDB entry 1k0t

View 1k0t on RCSB PDB site
Description: nmr solution structure of unbound, oxidized photosystem I subunit psac, containing [4fe-4s] clusters fa and fb
Class: electron transport
Keywords: iron-sulfur protein, solution structure, paramagnetic, conformational change, electron transport, photosystem I, psac
Deposited on 2001-09-20, released 2002-06-05
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: psac subunit of photosystem I
    Species: Synechococcus sp. [TaxId:32049]
    Gene: psac
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1k0ta_
  • Heterogens: SF4

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1k0tA (A:)
    shsvkiydtcigctqcvracpldvlemvpwdgckagqiassprtedcvgckrcetacptd
    flsirvylgaettrsmglay