PDB entry 1k0s

View 1k0s on RCSB PDB site
Description: Solution structure of the chemotaxis protein CheW from the thermophilic organism Thermotoga maritima
Class: signaling protein
Keywords: CheW, SIGNALING PROTEIN
Deposited on 2001-09-20, released 2002-02-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: chemotaxis protein chew
    Species: Thermotoga maritima [TaxId:2336]
    Gene: CheW
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1k0sa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1k0sA (A:)
    mktladalkefevlsfeideqalafdvdniemvieksditpvpksrhfvegvinlrgrii
    pvvnlakilgisfdeqkmksiivartkdvevgflvdrvlgvlritenqldltnvsdkfgk
    kskglvktdgrliiyldidkiieeitvkegv