PDB entry 1k0r

View 1k0r on RCSB PDB site
Description: Crystal Structure of Mycobacterium tuberculosis NusA
Class: transcription
Keywords: Two component arrangement, S1 domain, two K-homology domains., Structural Genomics, PSI, Protein Structure Initiative, TB Structural Genomics Consortium, TBSGC, TRANSCRIPTION
Deposited on 2001-09-20, released 2001-12-21
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.248
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: NusA
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MTCY24A1, number Z95207.1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A5M2 (19-End)
      • expression tag (14-18)
    Domains in SCOPe 2.05: d1k0ra1, d1k0ra2, d1k0ra3, d1k0ra4
  • Chain 'B':
    Compound: NusA
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MTCY24A1, number Z95207.1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A5M2 (19-End)
      • expression tag (14-18)
    Domains in SCOPe 2.05: d1k0rb1, d1k0rb2, d1k0rb3, d1k0rb4
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1k0rA (A:)
    mgsshhhhhhssglvsrrhmnidmaalhaievdrgisvnelletiksalltayrhtqghq
    tdarieidrktgvvrviaretdeagnlisewddtpegfgriaattarqvmlqrfrdaene
    rtygefstregeivagviqrdsranarglvvvrigtetkasegvipaaeqvpgesyehgn
    rlrcyvvgvtrgareplitlsrthpnlvrklfslevpeiadgsveivavareaghrskia
    vrsnvaglnakgacigpmgqrvrnvmselsgekidiidydddparfvanalspakvvsvs
    vidqtaraarvvvpdfqlslaigkegqnarlaarltgwridirgdapppppgqpepgvsr
    gmahdr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1k0rA (A:)
    vsrrhmnidmaalhaievdrgisvnelletiksalltayrhtqghqtdarieidrktgvv
    rviaretdeagnlisewddtpegfgriaattarqvmlqrfrdaestregeivagviqrds
    ranarglvvvrigtetkasegvipaaeqvpgesyehgnrlrcyvvgvtrgareplitlsr
    thpnlvrklfslevpeiadgsveivavareaghrskiavrsnvaglnakgacigpmgqrv
    rnvmselsgekidiidydddparfvanalspakvvsvsvidqtaraarvvvpdfqlslai
    gkegqnarlaarltgwridirgdapp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1k0rB (B:)
    mgsshhhhhhssglvsrrhmnidmaalhaievdrgisvnelletiksalltayrhtqghq
    tdarieidrktgvvrviaretdeagnlisewddtpegfgriaattarqvmlqrfrdaene
    rtygefstregeivagviqrdsranarglvvvrigtetkasegvipaaeqvpgesyehgn
    rlrcyvvgvtrgareplitlsrthpnlvrklfslevpeiadgsveivavareaghrskia
    vrsnvaglnakgacigpmgqrvrnvmselsgekidiidydddparfvanalspakvvsvs
    vidqtaraarvvvpdfqlslaigkegqnarlaarltgwridirgdapppppgqpepgvsr
    gmahdr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1k0rB (B:)
    vsrrhmnidmaalhaievdrgisvnelletiksalltayrhtqghqtdarieidrktgvv
    rviaretdeagnlisewddtpegfgriaattarqvmlqrfrdaestregeivagviqrds
    ranarglvvvrigtetkasegvipaaeqvpgesyehgnrlrcyvvgvtrgareplitlsr
    thpnlvrklfslevpeiadgsveivavareaghrskiavrsnvaglnakgacigpmgqrv
    rnvmselsgekidiidydddparfvanalspakvvsvsvidqtaraarvvvpdfqlslai
    gkegqnarlaarltgwridirgdapp