PDB entry 1k0p

View 1k0p on RCSB PDB site
Description: NMR Structures of the Zinc Finger Domain of Human DNA Polymerase-alpha
Class: transferase
Keywords: zinc finger protein, DNA binding domain, polymerase-alpha, TRANSFERASE
Deposited on 2001-09-20, released 2003-06-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: DNA polymerase alpha catalytic subunit
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • Uniprot P09884 (0-30)
  Domains in SCOPe 2.08: d1k0pa_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1k0pA (A:)
  iceeptcrnrtrhlplqfsrtgplcpacmka