PDB entry 1k0o

View 1k0o on RCSB PDB site
Description: Crystal structure of a soluble form of CLIC1. An intracellular chloride ion channel
Class: metal transport
Keywords: Glutathione-S-Transferase superfamily, CLIC1, NCC27, Chloride ion channel, METAL TRANSPORT
Deposited on 2001-09-19, released 2001-12-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.242
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: chloride intracellular channel protein 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O00299 (Start-240)
      • conflict (62)
      • engineered (150)
    Domains in SCOPe 2.07: d1k0oa1, d1k0oa2
  • Chain 'B':
    Compound: chloride intracellular channel protein 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O00299 (Start-240)
      • conflict (62)
    Domains in SCOPe 2.07: d1k0ob1, d1k0ob2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1k0oA (A:)
    maeeqpqvelfvkagsdgakigncpfsqrlfmvlwlkgvtfnvttvdtkrrtetvqklcp
    ggelpfllygtevhtdtnkieefleavlcpprypklaalnpesntagldifakfsayikn
    snpalndnlekgllkalkvldnyltsplpegvdetsaedegvsqrkfldgneltladcnl
    lpklhivqvvckkyrgftipeafrgvhrylsnayareefastcpddeeielayeqvakal
    k
    

    Sequence, based on observed residues (ATOM records): (download)
    >1k0oA (A:)
    pqvelfvkagsdgakigncpfsqrlfmvlwlkgvtfnvttvdtkrrtetvqklcpggelp
    fllygtevhtdtnkieefleavlcpprypklaalnpesntagldifakfsayiknsnpal
    ndnlekgllkalkvldnyltsplpegsqrkfldgneltladcnllpklhivqvvckkyrg
    ftipeafrgvhrylsnayareefastcpddeeielayeqvakalk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1k0oB (B:)
    maeeqpqvelfvkagsdgakigncpfsqrlfmvlwlkgvtfnvttvdtkrrtetvqklcp
    ggelpfllygtevhtdtnkieefleavlcpprypklaalnpesntagldifakfsayikn
    snpalndnlekgllkalkvldnyltsplpegvdetsaedegvsqrkfldgneltladcnl
    lpklhivqvvckkyrgftipeafrgvhrylsnayareefastcpddeeielayeqvakal
    k
    

    Sequence, based on observed residues (ATOM records): (download)
    >1k0oB (B:)
    pqvelfvkagsdgakigncpfsqrlfmvlwlkgvtfnvttvdtkrrtetvqklcpggelp
    fllygtevhtdtnkieefleavlcrypklaalsntagldifakfsayiknsnpalndnle
    kgllkalkvldnyltspkfldgneltladcnllpklhivqvvckkyrgftipeafrgvhr
    ylsnayareefastcpddeeielayeqvakalk