PDB entry 1k0k

View 1k0k on RCSB PDB site
Description: Yeast Profilin, Cubic Crystal Form
Class: contractile protein
Keywords: actin-binding protein, pip2 binding protein, poly-l-proline binding protein, contractile protein
Deposited on 2001-09-19, released 2001-10-03
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: 0.211
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Profilin
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1k0ka_
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1k0kA (A:)
    swqaytdnligtgkvdkaviysragdavwatsgglslqpneigeivqgfdnpaglqsngl
    hiqgqkfmllraddrsiygrhdaegvvcvrtkqtviiahypptvqageatkiveqladyl
    igvqy