PDB entry 1k0h

View 1k0h on RCSB PDB site
Description: Solution structure of bacteriophage lambda gpFII
Class: Viral protein
Keywords: twisted beta-sandwich, Viral protein
Deposited on 2001-09-19, released 2002-07-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: gpFII
    Species: Enterobacteria phage lambda [TaxId:10710]
    Gene: FII
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1k0ha_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1k0hA (A:)
    madfdnlfdaaiaradetirgymgtsatitsgeqsgavirgvfddpenisyagqgvrveg
    sspslfvrtdevrqlrrgdtltigeenfwvdrvspddggschlwlgrgvppavnrrr