PDB entry 1k0f

View 1k0f on RCSB PDB site
Description: Crystal structure of Zn(II)-free T. pallidum TroA
Class: transport protein
Keywords: apo protein, helix backbone, closed conformation, TRANSPORT PROTEIN
Deposited on 2001-09-19, released 2002-04-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.208
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Periplasmic zinc-binding protein troA
    Species: Treponema pallidum [TaxId:160]
    Gene: troa
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1k0fa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1k0fA (A:)
    gkplvvttigmiadavkniaqgdvhlkglmgpgvdphlytatagdvewlgnadlilyngl
    hletkmgevfsklrgsrlvvavsetipvsqrlsleeaefdphvwfdvklwsysvkavyes
    lckllpgktreftqryqayqqqldkldayvrrkaqslpaerrvlvtahdafgyfsraygf
    evkglqgvstaseasahdmqelaafiaqrklpaifiessiphknvealrdavqarghvvq
    iggelfsdamgdagtsegtyvgmvthnidtivaalar