PDB entry 1k0d

View 1k0d on RCSB PDB site
Description: Ure2p in Complex with Glutathione
Class: gene regulation
Keywords: Nitrate assimilation, Structural genomics, GENE REGULATION
Deposited on 2001-09-19, released 2001-12-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-12-07, with a file datestamp of 2011-12-02.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.213
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ure2 protein
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1k0da1, d1k0da2
  • Chain 'B':
    Compound: ure2 protein
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1k0db1, d1k0db2
  • Chain 'C':
    Compound: ure2 protein
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1k0dc1, d1k0dc2
  • Chain 'D':
    Compound: ure2 protein
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1k0dd1, d1k0dd2
  • Heterogens: GSH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1k0dA (A:)
    shveysritkffqeqplegytlfshrsapngfkvaivlselgfhyntifldfnlgehrap
    efvsvnpnarvpalidhgmdnlsiwesgaillhlvnkyyketgnpllwsddladqsqina
    wlffqtsghapmigqalhfryfhsqkiasaverytdevrrvygvvemalaerrealvmel
    dtenaaaysagttpmsqsrffdypvwlvgdkltiadlafvpwnnvvdriginikiefpev
    ykwtkhmmrrpavikalrge
    

    Sequence, based on observed residues (ATOM records): (download)
    >1k0dA (A:)
    qplegytlfshrsapngfkvaivlselgfhyntifldfnlgehrapefvsvnpnarvpal
    idhgmdnlsiwesgaillhlvnkyyketgnpllwsddladqsqinawlffqtsghapmig
    qalhfryfhsqkiasaverytdevrrvygvvemalaerrealvmfdypvwlvgdkltiad
    lafvpwnnvvdriginikiefpevykwtkhmmrrpavikal
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1k0dB (B:)
    shveysritkffqeqplegytlfshrsapngfkvaivlselgfhyntifldfnlgehrap
    efvsvnpnarvpalidhgmdnlsiwesgaillhlvnkyyketgnpllwsddladqsqina
    wlffqtsghapmigqalhfryfhsqkiasaverytdevrrvygvvemalaerrealvmel
    dtenaaaysagttpmsqsrffdypvwlvgdkltiadlafvpwnnvvdriginikiefpev
    ykwtkhmmrrpavikalrge
    

    Sequence, based on observed residues (ATOM records): (download)
    >1k0dB (B:)
    sritkffqeqplegytlfshrsapngfkvaivlselgfhyntifldfnlgehrapefvsv
    npnarvpalidhgmdnlsiwesgaillhlvnkyyketgnpllwsddladqsqinawlffq
    tsghapmigqalhfryfhsqkiasaverytdevrrvygvvemalaerrealvmdypvwlv
    gdkltiadlafvpwnnvvdriginikiefpevykwtkhmmrrpavikalrg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1k0dC (C:)
    shveysritkffqeqplegytlfshrsapngfkvaivlselgfhyntifldfnlgehrap
    efvsvnpnarvpalidhgmdnlsiwesgaillhlvnkyyketgnpllwsddladqsqina
    wlffqtsghapmigqalhfryfhsqkiasaverytdevrrvygvvemalaerrealvmel
    dtenaaaysagttpmsqsrffdypvwlvgdkltiadlafvpwnnvvdriginikiefpev
    ykwtkhmmrrpavikalrge
    

    Sequence, based on observed residues (ATOM records): (download)
    >1k0dC (C:)
    sritkffqeqplegytlfshrsapngfkvaivlselgfhyntifldfnlgehrapefvsv
    npnarvpalidhgmdnlsiwesgaillhlvnkyyketgnpllwsddladqsqinawlffq
    tsghapmigqalhfryfhsqkiasaverytdevrrvygvvemalaerrealvmelqsrff
    dypvwlvgdkltiadlafvpwnnvvdriginikiefpevykwtkhmmrrpavikalrge
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1k0dD (D:)
    shveysritkffqeqplegytlfshrsapngfkvaivlselgfhyntifldfnlgehrap
    efvsvnpnarvpalidhgmdnlsiwesgaillhlvnkyyketgnpllwsddladqsqina
    wlffqtsghapmigqalhfryfhsqkiasaverytdevrrvygvvemalaerrealvmel
    dtenaaaysagttpmsqsrffdypvwlvgdkltiadlafvpwnnvvdriginikiefpev
    ykwtkhmmrrpavikalrge
    

    Sequence, based on observed residues (ATOM records): (download)
    >1k0dD (D:)
    ysritkffqeqplegytlfshrsapngfkvaivlselgfhyntifldfnlgehrapefvs
    vnpnarvpalidhgmdnlsiwesgaillhlvnkyyketgnpllwsddladqsqinawlff
    qtsghapmigqalhfryfhsqkiasaverytdevrrvygvvemalaerrealvmeldffd
    ypvwlvgdkltiadlafvpwnnvvdriginikiefpevykwtkhmmrrpavikalrg