PDB entry 1k0a

View 1k0a on RCSB PDB site
Description: Ure2p in Complex with S-hexylglutathione
Class: gene regulation
Keywords: Nitrate assimilation, structural genomics, GENE REGULATION
Deposited on 2001-09-19, released 2001-12-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-12-21, with a file datestamp of 2011-12-16.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.218
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ure2 protein
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1k0aa1, d1k0aa2
  • Chain 'B':
    Compound: ure2 protein
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1k0ab1, d1k0ab2
  • Heterogens: GTX, GSH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1k0aA (A:)
    shveysritkffqeqplegytlfshrsapngfkvaivlselgfhyntifldfnlgehrap
    efvsvnpnarvpalidhgmdnlsiwesgaillhlvnkyyketgnpllwsddladqsqina
    wlffqtsghapmigqalhfryfhsqkiasaverytdevrrvygvvemalaerrealvmel
    dtenaaaysagttpmsqsrffdypvwlvgdkltiadlafvpwnnvvdriginikiefpev
    ykwtkhmmrrpavikalrge
    

    Sequence, based on observed residues (ATOM records): (download)
    >1k0aA (A:)
    sritkffqeqplegytlfshrsapngfkvaivlselgfhyntifldfnlgehrapefvsv
    npnarvpalidhgmdnlsiwesgaillhlvnkyyketgnpllwsddladqsqinawlffq
    tsghapmigqalhfryfhsqkiasaverytdevrrvygvvemalaerrealvmefdypvw
    lvgdkltiadlafvpwnnvvdriginikiefpevykwtkhmmrrpavikalrge
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1k0aB (B:)
    shveysritkffqeqplegytlfshrsapngfkvaivlselgfhyntifldfnlgehrap
    efvsvnpnarvpalidhgmdnlsiwesgaillhlvnkyyketgnpllwsddladqsqina
    wlffqtsghapmigqalhfryfhsqkiasaverytdevrrvygvvemalaerrealvmel
    dtenaaaysagttpmsqsrffdypvwlvgdkltiadlafvpwnnvvdriginikiefpev
    ykwtkhmmrrpavikalrge
    

    Sequence, based on observed residues (ATOM records): (download)
    >1k0aB (B:)
    qplegytlfshrsapngfkvaivlselgfhyntifldfnlgehrapefvsvnpnarvpal
    idhgmdnlsiwesgaillhlvnkyyketgnpllwsddladqsqinawlffqtsghapmig
    qalhfryfhsqkiasaverytdevrrvygvvemalaerrealvmefdypvwlvgdkltia
    dlafvpwnnvvdriginikiefpevykwtkhmmrrpavikalr