PDB entry 1k07

View 1k07 on RCSB PDB site
Description: Native FEZ-1 metallo-beta-lactamase from Legionella gormanii
Class: hydrolase
Keywords: monomer with alpha-beta/beta-alpha fold. Two monomers per assymmetric unit., HYDROLASE
Deposited on 2001-09-18, released 2003-01-21
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.174
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: FEZ-1 beta-lactamase
    Species: Fluoribacter gormanii [TaxId:464]
    Gene: blaFEZ-1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9K578 (Start-262)
      • see remark 999 (228)
      • see remark 999 (262)
    Domains in SCOPe 2.03: d1k07a_
  • Chain 'B':
    Compound: FEZ-1 beta-lactamase
    Species: Fluoribacter gormanii [TaxId:464]
    Gene: blaFEZ-1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9K578 (Start-262)
      • see remark 999 (228)
      • see remark 999 (262)
    Domains in SCOPe 2.03: d1k07b_
  • Heterogens: ZN, SO4, ACT, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1k07A (A:)
    aypmpnpfppfriagnlyyvgtddlasylivtprgnilinsdleanvpmikasikklgfk
    fsdtkillishahfdhaagselikqqtkakymvmdedvsvilsggksdfhyandsstyft
    qstvdkvlhdgervelggtvltahltpghtrgcttwtmklkdhgkqyqaviigsigvnpg
    yklvdnitypkiaedykhsikvlesmrcdiflgshagmfdlknkyvllskgqnnpfvdpt
    gcknyieqkandfytelkkqetg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1k07A (A:)
    ypmpnpfppfriagnlyyvgtddlasylivtprgnilinsdleanvpmikasikklgfkf
    sdtkillishahfdhaagselikqqtkakymvmdedvsvilsggksdfhyandsstyftq
    stvdkvlhdgervelggtvltahltpghtrgcttwtmklkdhgkqyqaviigsigvnpgy
    klvdnitypkiaedykhsikvlesmrcdiflgshagmfdlknkyvllskgqnnpfvdptg
    cknyieqkandfytelkkqetg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1k07B (B:)
    aypmpnpfppfriagnlyyvgtddlasylivtprgnilinsdleanvpmikasikklgfk
    fsdtkillishahfdhaagselikqqtkakymvmdedvsvilsggksdfhyandsstyft
    qstvdkvlhdgervelggtvltahltpghtrgcttwtmklkdhgkqyqaviigsigvnpg
    yklvdnitypkiaedykhsikvlesmrcdiflgshagmfdlknkyvllskgqnnpfvdpt
    gcknyieqkandfytelkkqetg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1k07B (B:)
    ypmpnpfppfriagnlyyvgtddlasylivtprgnilinsdleanvpmikasikklgfkf
    sdtkillishahfdhaagselikqqtkakymvmdedvsvilsggksdfhyandsstyftq
    stvdkvlhdgervelggtvltahltpghtrgcttwtmklkdhgkqyqaviigsigvnpgy
    klvdnitypkiaedykhsikvlesmrcdiflgshagmfdlknkyvllskgqnnpfvdptg
    cknyieqkandfytelkkqetg