PDB entry 1jzs

View 1jzs on RCSB PDB site
Description: Isoleucyl-tRNA synthetase Complexed with mupirocin
Class: ligase
Keywords: aminoacyl-tRNA synthetase, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics, LIGASE
Deposited on 2001-09-17, released 2001-12-21
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.249
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: isoleucyl-tRNA synthetase
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1jzsa1, d1jzsa2, d1jzsa3
  • Heterogens: ZN, MRC

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jzsA (A:)
    mfkevgepnfpkleeevlafwkrekifqksvenrkggprytvyegpptanglphvghaqa
    rsykdlfpryktmrgyyaprragwdthglpvelevekklglkskreieaygierfnqacr
    esvftyekeweafteriaywvdledayatleptyiesiwwslknlfdrgllyrdhkvvpy
    cprcgtplsshevalgykeiqdpsvyvrfplkepkklglekaslliwtttpwtlpgnvaa
    avhpeytyaafqvgdealileeglgrkllgegtqvlktfpgkaleglpytppypqalekg
    yfvvladyvsqedgtgivhqapafgaedletarvyglpllktvdeegkllvepfkglyfr
    eanrailrdlrgrgllfkeesylhsyphcwrcstplmyyateswfikntlfkdelirnnq
    eihwvpphikegrygewlknlvdwalsrnrywgtplpiwvcqacgkeeaigsfqelkara
    tkplpepfdphrpyvdqvelacacggtmrrvpyvidvwydsgampfaslhypfeheevfr
    esfpadfiaegidqtrgwfnslhqlgvmlfgsiafknvichglildekgqkmskskgnvv
    dpwdiirkfgadalrwyiyvsappeadrrfgpnlvretvrdyfltlwnvysffvtyanld
    rpdlknppppekrpemdrwllarmqdliqrvtealeaydpttsaralrdfvvedlsqwyv
    rrnrrrfwknedaldreaayatlyealvlvatlaapftpflaevlwqnlvrsvrleakes
    vhladwpeadpaladealvaqmravlkvvdlaraaraksgv