PDB entry 1jzs

View 1jzs on RCSB PDB site
Description: Isoleucyl-tRNA synthetase Complexed with mupirocin
Deposited on 2001-09-17, released 2001-12-21
The last revision prior to the SCOP 1.59 freeze date was dated 2001-12-21, with a file datestamp of 2001-12-21.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.249
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jzsA (A:)
    mfkevgepnfpkleeevlafwkrekifqksvenrkggprytvyegpptanglphvghaqa
    rsykdlfpryktmrgyyaprragwdthglpvelevekklglkskreieaygierfnqacr
    esvftyekeweafteriaywvdledayatleptyiesiwwslknlfdrgllyrdhkvvpy
    cprcgtplsshevalgykeiqdpsvyvrfplkepkklglekaslliwtttpwtlpgnvaa
    avhpeytyaafqvgdealileeglgrkllgegtqvlktfpgkaleglpytppypqalekg
    yfvvladyvsqedgtgivhqapafgaedletarvyglpllktvdeegkllvepfkglyfr
    eanrailrdlrgrgllfkeesylhsyphcwrcstplmyyateswfikntlfkdelirnnq
    eihwvpphikegrygewlknlvdwalsrnrywgtplpiwvcqacgkeeaigsfqelkara
    tkplpepfdphrpyvdqvelacacggtmrrvpyvidvwydsgampfaslhypfeheevfr
    esfpadfiaegidqtrgwfnslhqlgvmlfgsiafknvichglildekgqkmskskgnvv
    dpwdiirkfgadalrwyiyvsappeadrrfgpnlvretvrdyfltlwnvysffvtyanld
    rpdlknppppekrpemdrwllarmqdliqrvtealeaydpttsaralrdfvvedlsqwyv
    rrnrrrfwknedaldreaayatlyealvlvatlaapftpflaevlwqnlvrsvrleakes
    vhladwpeadpaladealvaqmravlkvvdlaraaraksgv