PDB entry 1jzh

View 1jzh on RCSB PDB site
Description: Pseudomonas aeruginosa Azurin Ru(tpy)(bpy)(His83)
Class: electron transport
Keywords: Blue-copper, Electron Transfer, Tunneling, Ruthenium, ELECTRON TRANSPORT
Deposited on 2001-09-16, released 2001-10-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.269
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Azurin
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1jzha_
  • Heterogens: CU, RTA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jzhA (A:)
    aecsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnwvlstaadmqgvv
    tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffctfpghsal
    mkgtltlk